DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: xit and Alg8

Sequence 1:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_950200.2 Gene:Alg8 MGIID:2141959 Length:526 Species:Mus musculus

Alignment Length:521 Identity:256/522 (49%)
Similarity:329/522 (63%) Gaps:42/522 (8%)


  Fly    13 TGLKILLIPAYHSTDFEVHRNWLAITHSLPLNQWYVDATSEWTLDYPPFFAYFEWLLSQVAKYVD 77
            |.||.||||.||||||||||||||||||||::|||.:||||||||||||||:||:.||.:|||.|
Mouse    22 TLLKCLLIPTYHSTDFEVHRNWLAITHSLPISQWYYEATSEWTLDYPPFFAWFEYALSHIAKYFD 86

  Fly    78 PRMLVVDNLNYESKATVYFQRLSVIVTDLVYVLGVR---SCLGSLGLGRDTQQ--FFAASMLLLL 137
            ..||.:.||||.|..|:.|||.|||:||.::|..|.   .|:.....|:|..:  .|..|:|||.
Mouse    87 QEMLNIHNLNYYSSRTLLFQRFSVILTDALFVYAVHECCKCIDGKRTGKDLTEKPKFILSVLLLW 151

  Fly   138 NVGLIFVDHIHFQYNGLLFGILLLSIGSLIRQRFLWSAFAFAVLLNFKHIFLYMAPAFGVYLLRF 202
            |.||:.||||||||||.|.|:|||||..|.::|.:..|..|||||:.|||:||:|||:||||||.
Mouse   152 NFGLLIVDHIHFQYNGFLSGLLLLSIARLFQKRHIEGALLFAVLLHLKHIYLYVAPAYGVYLLRS 216

  Fly   203 YCL----EQASVVSAVGAVVKLLVVGLTPF---AVSFGPF--WQQLPQVLSRLFPFKRGLTHAYW 258
            ||.    ...||..:..:||::..:||..|   |:|.|||  ..|||||.||||||||||.||||
Mouse   217 YCFTASKPDGSVRWSSFSVVRVTSLGLIVFLVSALSLGPFLALNQLPQVFSRLFPFKRGLCHAYW 281

  Fly   259 APNFWALYNAADKLAAGV---LKVQDGG----ASTTSGLVQEVRHSVLPAITPPVTFALTALFML 316
            ||||||||||.||:.:.:   ||:.|..    ||.||||||:.:|:|||:::|..|...|.:.:|
Mouse   282 APNFWALYNALDKVLSVIGLKLKLLDPSQIPRASMTSGLVQQFQHTVLPSVSPLATLICTLIAIL 346

  Fly   317 PILVKLFRSAKKQSPLVFLRAVVLCGCSSFVFGWHVHEKAILMVLLPLCLLTLVNREDARYAYVL 381
            |.:..|:  .|.|.|..|||.:|||..|||:|||||||||||:.:||:.||::....||....:|
Mouse   347 PSVFCLW--FKPQGPRGFLRCLVLCALSSFMFGWHVHEKAILLAILPMSLLSVEKAGDATVFLIL 409

  Fly   382 GIAGYFSLFPLLFDADLYIPRYSLYMSYVAMMYGQLYRIFPGFRG-FHTLEWLYMLGFMAIPLYE 445
            ...|::|||||||.|.....:..|.:.:.......|..:|...:. |:.:|.:|:||..  || |
Mouse   410 ATTGHYSLFPLLFTAPELPIKILLMLLFTVYSISSLKTLFRKEKPLFNWMETVYLLGLG--PL-E 471

  Fly   446 HLLSFLLHLDQ---RLPFLPLLLTSVYSALGVLYFFGAYYLYALGISWGKVPIASSTSAAAVKRK 507
            ....|||....   :.||:||||||||.|:|:.|            :|.::..:..|.:...|.|
Mouse   472 VCCEFLLPFTSWKLKYPFIPLLLTSVYCAVGITY------------AWTRLYASVLTGSLVSKTK 524

  Fly   508 R 508
            :
Mouse   525 K 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 252/490 (51%)
Alg8NP_950200.2 Alg6_Alg8 22..507 CDD:281190 252/502 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262821981
eggNOG 1 0.900 E1_KOG2576
Hieranoid 1 1.000
Homologene 1 1.000 H6931
Inparanoid 1 1.050 443 1.000 Inparanoid score I1626
Isobase 1 0.950 0.741681 Normalized mean entropy S1324
OMA 1 1.010
OrthoDB 1 1.010 D379099at33208
OrthoFinder 1 1.000 FOG0004496
OrthoInspector 1 1.000 T1085588
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12413
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R45
TreeFam 1 0.960
1413.850

Return to query results.
Submit another query.