DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: xit and Alg6

Sequence 1:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001028881.1 Gene:Alg6 RGDID:1308815 Length:507 Species:Rattus norvegicus

Alignment Length:498 Identity:144/499 (29%)
Similarity:223/499 (45%) Gaps:73/499 (15%)


  Fly     1 MKDLFWHLVGIATGLKI---LLIPAYHST-------DFEVHRNWLAITHSLPLNQWYVDATSE-- 53
            |:...|..|.:..||.:   :.:.:|...       |:|..|:|..||.:||:.|||.:::..  
  Rat     1 MESWTWMTVVVLLGLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITLNLPVKQWYFNSSDNNL 65

  Fly    54 --WTLDYPPFFAYFEWLLSQVAKYVDPRMLVV-DNLNYESKATVYFQRLSVIVTD-LVYVLGVRS 114
              |.|||||..||...|.:.|||:::|..:.: .:..|||:|...|.|.:|:..| |:|:..|..
  Rat    66 QYWGLDYPPLTAYHSLLCAYVAKFINPDWVALHTSRGYESQAHKLFMRTTVLAADLLIYIPAVLL 130

  Fly   115 CLGSLGLGRDTQQFFAASMLLLLNVGLIFVDHIHFQYNGLLFGILLLSIGSLIRQRFLWSAFAFA 179
            ...|| .....::..|:::.:||..|||.:|:.|||||.:..|..|..:..:.....|..:.||.
  Rat   131 YCYSL-KEISPKRKIASALCILLYPGLILIDYGHFQYNSVSLGFALWGVLGVSCDWDLLGSLAFC 194

  Fly   180 VLLNFKHIFLYMAPAFGVYLLRFYCLEQASVVSAVGAVVKLLVVGLTPFAVSFGPFW---QQLPQ 241
            :.||:|.:.||.:..|..:||. .|.::..........:::....:..|.:.:.||.   :...|
  Rat   195 LALNYKQMELYHSLPFFCFLLG-KCFKKGLRGKGSALFIRIACTVVASFLLCWLPFLTEREHALQ 258

  Fly   242 VLSRLFPFKRGLTHAYWAPNFWALYNAADKLAAGVLKVQDGGASTTSGLVQEVRHSVLPA-ITPP 305
            |:.||||..|||.....| |.|...|.       .||::|                :||. |...
  Rat   259 VVRRLFPVDRGLFEDKVA-NIWCSLNV-------FLKIKD----------------ILPRHIQIA 299

  Fly   306 VTFALTALFMLPILVKLFRSAKKQSPLVFLRAVVLCGCSSFVFGWHVHEKAILMVLLPLCL-LTL 369
            ::|..|.|.:||..:||   ..:.|...|...:|.|..|.|:|.:.||||:||:|.||:|| ||.
  Rat   300 ISFCFTFLSLLPACIKL---TVQPSAKGFRFTLVSCALSFFLFSFQVHEKSILLVSLPVCLVLTE 361

  Fly   370 VNREDARYAYVLGIAGYFSLFPLLFDADLYIPRYSLYMSYVAMMYGQLYRIFPGFRGFHTLEWLY 434
            :......:..|    ..||:.|||....|.:|.....|:::.    .....||.|.  :|.|...
  Rat   362 IPFMSTWFLLV----STFSMLPLLLKDQLLLPSVVTVMAFLI----ACSTFFPMFE--NTSEEQL 416

  Fly   435 MLGFMAIPLYEHLLSFLLHLDQRLPFLP-----LLLTSVYSAL 472
            .|...|:.:..||..|        .|||     |.|:||.:.:
  Rat   417 QLKSFAVSVRRHLPGF--------TFLPRIIQCLFLSSVITMI 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 141/488 (29%)
Alg6NP_001028881.1 Alg6_Alg8 32..487 CDD:281190 138/468 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D379099at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.