DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: xit and alg8

Sequence 1:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001017647.1 Gene:alg8 ZFINID:ZDB-GENE-030131-5812 Length:524 Species:Danio rerio

Alignment Length:530 Identity:270/531 (51%)
Similarity:340/531 (64%) Gaps:42/531 (8%)


  Fly     3 DLFWHLVGIATG---LKILLIPAYHSTDFEVHRNWLAITHSLPLNQWYVDATSEWTLDYPPFFAY 64
            |..| ...:|.|   ||.|||.|||||||||||||||:|||||::|||.:|||||||||||.||:
Zfish     8 DQSW-FFALALGVSFLKCLLINAYHSTDFEVHRNWLALTHSLPVSQWYYEATSEWTLDYPPLFAW 71

  Fly    65 FEWLLSQVAKYVDPRMLVVDNLNYESKATVYFQRLSVIVTDLVYVLGVRSCLGSL--GLGRDT-- 125
            ||:.||.:|::.|..||||:||||.|.|||.||||||||||.|....|:.|...|  ..|:|.  
Zfish    72 FEYGLSHIARFFDKEMLVVENLNYASPATVLFQRLSVIVTDAVLFYAVKECCKCLREDKGKDLLG 136

  Fly   126 QQFFAASMLLLLNVGLIFVDHIHFQYNGLLFGILLLSIGSLIRQRFLWSAFAFAVLLNFKHIFLY 190
            :..|..::|||.|.||:.||||||||||.|||:|||||...::.|.|..|..|::|||.|||:||
Zfish   137 KPSFILTVLLLWNFGLLIVDHIHFQYNGFLFGVLLLSIARHLQNRHLEGALLFSILLNLKHIYLY 201

  Fly   191 MAPAFGVYLLRFYCLEQASVVSAVG----AVVKLLVVG---LTPFAVSFGPFWQ--QLPQVLSRL 246
            :|||:|::|||.:|..|::...::.    :|::|:.:|   |:.||||.|||..  |||||||||
Zfish   202 IAPAYGIFLLRCFCFTQSNPDGSLSWRSFSVLRLVALGTIVLSTFAVSIGPFLALGQLPQVLSRL 266

  Fly   247 FPFKRGLTHAYWAPNFWALYNAADKLAA--GV-LKVQDGG----ASTTSGLVQEVRHSVLPAITP 304
            |||||||.|||||||.|||||.|||..:  || .|:.|..    ||.|.|||||.:|||||:::|
Zfish   267 FPFKRGLCHAYWAPNIWALYNIADKALSILGVKFKLLDMNKLPKASMTGGLVQEFQHSVLPSVSP 331

  Fly   305 PVTFALTALFMLPILVKLFRSAKKQSPLVFLRAVVLCGCSSFVFGWHVHEKAILMVLLPLCLLTL 369
            ..|...|.|.:||.|.||:.  :......|||.:|:|...||:|||||||||||||:|||.||.:
Zfish   332 LATLICTLLSILPALFKLWH--RPNGTRGFLRCLVVCALGSFMFGWHVHEKAILMVILPLSLLAV 394

  Fly   370 VNREDARYAYVLGIAGYFSLFPLLFDADLYIPRYSLYMSYVAMMYGQLYRIF-PGFRGFHTLEWL 433
            .:|||||...:|.|.|::|||||||.......:..|.:.:.......|..:| .|....:.||.:
Zfish   395 ESREDARTFLILSITGHYSLFPLLFTTQELPIKLFLMLLFTIFSVTSLKMLFRKGGSLLNPLESM 459

  Fly   434 YMLGFMAIPLYEHLLSFLLHL---DQRLPFLPLLLTSVYSALGVLYFFGAYYLYALGISWGKVPI 495
            |:||.  ||| |.:..|:..|   .:..|||||:|||:|.||||.|.|...|:..|         
Zfish   460 YLLGL--IPL-ELVCEFIYPLTVWQKTFPFLPLMLTSLYCALGVTYAFIRLYISML--------- 512

  Fly   496 ASSTSAAAVK 505
            .||.:|..||
Zfish   513 TSSDTAKKVK 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 260/493 (53%)
alg8NP_001017647.1 Alg6_Alg8 20..506 CDD:281190 259/491 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262820914
eggNOG 1 0.900 E1_KOG2576
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6931
Inparanoid 1 1.050 456 1.000 Inparanoid score I1519
OMA 1 1.010
OrthoDB 1 1.010 D379099at33208
OrthoFinder 1 1.000 FOG0004496
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12413
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R45
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.