DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment xit and ALG6

DIOPT Version :8

Sequence 1:NP_572355.1 Gene:xit / 31623 FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_037471.2 Gene:ALG6 / 29929 HGNCID:23157 Length:507 Species:Homo sapiens

Alignment Length:524 Identity:145/525 (28%)
Similarity:239/525 (46%) Gaps:94/525 (18%)


  Fly     6 WHL--VGIATGLKI---LLIPAYHST-------DFEVHRNWLAITHSLPLNQWYVDATSE----W 54
            |:|  |.:..||.:   :.:.:|...       |:|..|:|..||.:||:.|||.:::..    |
Human     4 WYLMTVVVLIGLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYW 68

  Fly    55 TLDYPPFFAYFEWLLSQVAKYVDPRMLVV-DNLNYESKATVYFQRLSVIVTD-LVYVLGV---RS 114
            .|||||..||...|.:.|||:::|..:.: .:..|||:|...|.|.:|::.| |:|:..|   ..
Human    69 GLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLIYIPAVVLYCC 133

  Fly   115 CLGSLGLGRDTQQFFAASMLLLLNVGLIFVDHIHFQYNGLLFGILLLSIGSLIRQRFLWSAFAFA 179
            ||..:    .|::..|.::.:||..|||.:|:.|||||.:..|..|..:..:.....|..:.||.
Human   134 CLKEI----STKKKIANALCILLYPGLILIDYGHFQYNSVSLGFALWGVLGISCDCDLLGSLAFC 194

  Fly   180 VLLNFKHIFLYMAPAFGVYLLRFYCLEQASVVSAVGAVVKLLVVGLTPFAVSFGPFW---QQLPQ 241
            :.:|:|.:.||.|..|..:||. .|.::.........:|||..:.:..|.:.:.||:   :|..|
Human   195 LAINYKQMELYHALPFFCFLLG-KCFKKGLKGKGFVLLVKLACIVVASFVLCWLPFFTEREQTLQ 258

  Fly   242 VLSRLFPFKRGLTHAYWAPNFWALYNAADKLAAGVLKVQDGGASTTSGLVQEVRHSVLPA-ITPP 305
            ||.||||..|||.....| |.|..:|.       .||::|                :||. |...
Human   259 VLRRLFPVDRGLFEDKVA-NIWCSFNV-------FLKIKD----------------ILPRHIQLI 299

  Fly   306 VTFALTALFMLPILVKLFRSAKKQSPLVFLRAVVLCGCSSFVFGWHVHEKAILMVLLPLCL---- 366
            ::|..|.|.:||..:||......:.   |...:|.|..|.|:|.:.||||:||:|.||:||    
Human   300 MSFCSTFLSLLPACIKLILQPSSKG---FKFTLVSCALSFFLFSFQVHEKSILLVSLPVCLVLSE 361

  Fly   367 ----------------LTLVNRED-------ARYAYVLGIAGYFSLFPLLFDADLYIPRYSLYMS 408
                            |.|:.:::       ...|:.:.....||:|....:.:|.:..:|:.:.
Human   362 IPFMSTWFLLVSTFSMLPLLLKDELLMPSVVTTMAFFIACVTSFSIFEKTSEEELQLKSFSISVR 426

  Fly   409 YVAMMYGQLYRIFPGFRGFHTLEWLYMLGFMAIPLYEHLLSFLLHLDQRLPFLPLLLTSVYSALG 473
            .....:..|.||         :::|:::..:.:.|.. |::..|...|:||.|..:|....|.|.
Human   427 KYLPCFTFLSRI---------IQYLFLISVITMVLLT-LMTVTLDPPQKLPDLFSVLVCFVSCLN 481

  Fly   474 VLYF 477
            .|:|
Human   482 FLFF 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 142/517 (27%)
ALG6NP_037471.2 Alg6_Alg8 32..485 CDD:308661 138/495 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D379099at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.