DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: xit and Alg8

Sequence 1:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001029299.1 Gene:Alg8 RGDID:1305468 Length:526 Species:Rattus norvegicus

Alignment Length:540 Identity:259/541 (48%)
Similarity:331/541 (61%) Gaps:60/541 (11%)


  Fly    10 GIATG--------------LKILLIPAYHSTDFEVHRNWLAITHSLPLNQWYVDATSEWTLDYPP 60
            |:|.|              ||.||||.|||||||||||||||||:||::|||.:|||||||||||
  Rat     5 GLAAGSGHWFSALALGVTLLKCLLIPTYHSTDFEVHRNWLAITHNLPISQWYYEATSEWTLDYPP 69

  Fly    61 FFAYFEWLLSQVAKYVDPRMLVVDNLNYESKATVYFQRLSVIVTDLVYVLGVR---SCLGSLGLG 122
            |||:||:.||.:|||.|..||.:.||||.|..|:.|||.|||:||.::|..|.   .|:.....|
  Rat    70 FFAWFEYALSHIAKYFDQEMLDIHNLNYYSSRTLLFQRFSVILTDALFVYAVHECCKCIDGKRTG 134

  Fly   123 RDTQQ--FFAASMLLLLNVGLIFVDHIHFQYNGLLFGILLLSIGSLIRQRFLWSAFAFAVLLNFK 185
            :|..:  .|..|:|||.|.||:.||||||||||||.|:|||||..|.::|.:..||.|||||:||
  Rat   135 KDPTEKPKFVLSVLLLWNFGLLIVDHIHFQYNGLLSGLLLLSIARLFQKRHIEGAFLFAVLLHFK 199

  Fly   186 HIFLYMAPAFGVYLLRFYCLEQASVVSAVG----AVVKLLVVGLTPF---AVSFGPF--WQQLPQ 241
            ||:||:|||:|:||||.||...:....:|.    ::|::..:.|..|   |:|.|||  ..||||
  Rat   200 HIYLYVAPAYGIYLLRSYCFTASKPDGSVRWDSFSIVRVTALALIVFLVSALSLGPFLALNQLPQ 264

  Fly   242 VLSRLFPFKRGLTHAYWAPNFWALYNAADK--LAAGV-LKVQDGG----ASTTSGLVQEVRHSVL 299
            |.||||||||||.||||||||||||:|.||  ...|: ||:.|..    ||.||||||:.:|:||
  Rat   265 VFSRLFPFKRGLCHAYWAPNFWALYSALDKALCVTGLELKLLDPSQIPRASMTSGLVQQSQHTVL 329

  Fly   300 PAITPPVTFALTALFMLPILVKLFRSAKKQSPLVFLRAVVLCGCSSFVFGWHVHEKAILMVLLPL 364
            |:::|..|...|.:.:||.:..|:  .|.|.|..|||.:|||..|||:|||||||||||:.:||:
  Rat   330 PSVSPSATLICTLIAILPSVFCLW--FKPQGPRGFLRCLVLCALSSFMFGWHVHEKAILLAILPM 392

  Fly   365 CLLTLVNREDARYAYVLGIAGYFSLFPLLFDA---DLYIPRYSLYMSYVAMMYGQLYRIFPGFRG 426
            .||.:....||....:|...|::|||||||.|   .:.|...||:..|.......|:|.....  
  Rat   393 SLLAVEKAGDATIFLILTTTGHYSLFPLLFTAPELPIKILLMSLFTVYSISSLRTLFRKEKPL-- 455

  Fly   427 FHTLEWLYMLGFMAIPLYEHLLSFLLHLDQ---RLPFLPLLLTSVYSALGVLYFFGAYYLYALGI 488
            |:.:|.||:||..  || |....||.....   :.||:||||||||.|:|:.|            
  Rat   456 FNWMETLYLLGLG--PL-EVCCEFLFPFTSWKLKYPFIPLLLTSVYCAVGITY------------ 505

  Fly   489 SWGKVPIASSTSAAAVKRKR 508
            :|.::..:..|.....|.|:
  Rat   506 AWIRLYASVLTGCLVSKTKK 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 254/507 (50%)
Alg8NP_001029299.1 Alg6_Alg8 22..509 CDD:281190 253/506 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262825049
eggNOG 1 0.900 E1_KOG2576
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6931
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D379099at33208
OrthoFinder 1 1.000 FOG0004496
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12413
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.