DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: xit and alg8

Sequence 1:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_594599.1 Gene:alg8 PomBaseID:SPAC17C9.07 Length:501 Species:Schizosaccharomyces pombe

Alignment Length:498 Identity:217/499 (43%)
Similarity:305/499 (61%) Gaps:40/499 (8%)


  Fly    12 ATGLKILLIPAYHSTDFEVHRNWLAITHSLPLNQWYVDATSEWTLDYPPFFAYFEWLLSQVAKY- 75
            :|.:|:.|.|:|.||||||||||||||||||:::||..:.|||||||||||||.|.:||.:|.: 
pombe    14 STFVKVFLFPSYRSTDFEVHRNWLAITHSLPISEWYKSSISEWTLDYPPFFAYMECVLSWIAYFF 78

  Fly    76 -VDPRMLVVDNLNYESKATVYFQRLSVIVTDLVYVLGVRSCLGSLGLGRDTQQFFAASMLLLLNV 139
             .|..||...||||.|.:||.|||.||||.:||.:..:|..:.|..: :|.:.....::.:.|:.
pombe    79 GFDKAMLDPYNLNYVSPSTVVFQRGSVIVLELVLLFALREYVLSSNV-KDQRNALLTAIDIFLSP 142

  Fly   140 GLIFVDHIHFQYNGLLFGILLLSIG-SLIRQRFLWSAFAFAVLLNFKHIFLYMAPAFGVYLLRFY 203
            ||:.:|||||||||.|||:||.||. :...:..|.||..|:.|:.|||||||:|||:.|||||.|
pombe   143 GLLIIDHIHFQYNGFLFGLLLWSIVLAKPEKNMLLSAAIFSALICFKHIFLYVAPAYFVYLLRVY 207

  Fly   204 CL-----EQASVVSAVGAVVKLLVVGLTPFAVSFGP--FWQQLPQVLSRLFPFKRGLTHAYWAPN 261
            |.     .|...:..:|:.|      ::.|.::|||  :.:|:||:|||||||.|||.|||||||
pombe   208 CFTPNFRPQFLNILKLGSTV------ISIFLLAFGPWIYMKQIPQLLSRLFPFSRGLCHAYWAPN 266

  Fly   262 FWALYNAADKLAAGVL-----KVQDGGA--STTSGLVQEVRHSVLPAITPPVTFALTALFMLPIL 319
            |||||:..|::|..||     .:..|.:  :.|.|||.|...:|||.|.|.:||.:.....:.:|
pombe   267 FWALYSFVDRVAFAVLPRFGYALNQGTSINAPTRGLVGESSFAVLPNIPPALTFYICLGLQITVL 331

  Fly   320 VKLFRSAKKQSPLVFLRAVVLCGCSSFVFGWHVHEKAILMVLLPLCLLTLVNREDARYAYVLGIA 384
            :|||   .|.:..||:.||.|||..||:|||||||||||||:||..:|:|::|........|.::
pombe   332 IKLF---IKPTWRVFVGAVTLCGWISFLFGWHVHEKAILMVILPFSILSLIDRRYLEAFRPLAVS 393

  Fly   385 GYFSLFPLLFDADLYIPRYSLYMSYVAMMYG-------QLYRIFPGFRGFHTLEWLYMLGFMAIP 442
            ||.||.||||..:....:|....:::||:..       .:.|:|.    .:.:...|:.||:.:.
pombe   394 GYLSLLPLLFTLNEAPIKYLFTGAWIAMLLTFDKCAPVPVKRVFL----LNRVNIAYISGFVPLF 454

  Fly   443 LYEHLLSFLLHLDQRLPFLPLLLTSVYSALGVLY-FFGAYYLY 484
            :|...:..|: :..:..||||:|.|.|:|.|:.: |....:||
pombe   455 IYNCFIHKLV-MGDKFEFLPLMLLSTYAAWGIFWSFVSLLWLY 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 215/491 (44%)
alg8NP_594599.1 Alg6_Alg8 14..490 CDD:281190 215/491 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6931
Inparanoid 1 1.050 363 1.000 Inparanoid score I445
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004496
OrthoInspector 1 1.000 T1125954
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12413
Phylome 1 0.910 0.671 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R45
TreeFam 1 0.960
1010.060

Return to query results.
Submit another query.