DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: xit and algn-8

Sequence 1:NP_572355.1 Gene:xit FlyBaseID:FBgn0029906 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001021940.2 Gene:algn-8 WormBaseID:WBGene00007464 Length:766 Species:Caenorhabditis elegans

Alignment Length:516 Identity:200/517 (39%)
Similarity:268/517 (52%) Gaps:40/517 (8%)


  Fly     8 LVGIATGLKILLIPAYHSTDFEVHRNWLAITHSLPLNQWYVDATSEWTLDYPPFFAYFEWLLSQV 72
            :..|....|.||||||.||||||||||:|:|...||.:||.:|||||||||||||||||..|:.|
 Worm    10 VTAILISFKCLLIPAYVSTDFEVHRNWMAVTWQRPLCEWYTEATSEWTLDYPPFFAYFELGLASV 74

  Fly    73 AKYVD-PRMLVVDNLNYESKATVYFQRLSVIVTDLVYV-----LGVRSCLGSLGLGRDTQQ--FF 129
            |.:.. ...||:......|:..:.|||.|||..|::|:     ...||......:.:..||  ..
 Worm    75 AHFFGFDECLVISKTPRFSRRILIFQRFSVIFCDILYIAVCALYSFRSPRLVSRIPKKLQQNGRE 139

  Fly   130 AASMLLLLNVGLIFVDHIHFQYNGLLFGILLLSIGSLIRQRFLWSAFAFAVLLNFKHIFLYMAPA 194
            |..:||.....||..|.||||||.:|..|.|:|:..:..:|:|.:|.::::|||||||::|.|..
 Worm   140 ACFVLLASLQALIICDSIHFQYNSMLTAIFLMSLFFIDTERYLMAALSYSILLNFKHIYVYYALG 204

  Fly   195 FGVYLLRFYCLEQASVVSA-VGAVVKLLVVGLTPFAVSFGPF-----WQQLPQVLSRLFPFKRGL 253
            :..|.|..|.....:|:.| ....:.|.:..|.||..|..||     .|.|..:.:||||..|||
 Worm   205 YVFYYLVNYFQFSGNVLLANTPKAISLAIALLIPFCASIFPFIHASGVQGLQNIATRLFPVSRGL 269

  Fly   254 THAYWAPNFWALYNAADKL---AAGVLKVQDGGAST-TSGLVQEVRHSVLPAITPPVTFALTALF 314
            ||||||||||||||.||..   ...:||:....|.| |||||||..|||||.::|..|..|..:.
 Worm   270 THAYWAPNFWALYNFADLCLYRVLSLLKIGKFDAPTYTSGLVQEYSHSVLPNVSPMGTLCLVVIS 334

  Fly   315 MLPILVKLFRSAKKQSPLVFLRAVVLCGCSSFVFGWHVHEKAILMVLLPLCLLTLVNREDARYAY 379
            .:.:|..|. ..:|.|....|.||....| .|.||:|||||||::|.:|:.:..:.|.:......
 Worm   335 SMIVLTGLV-IRRKDSADFSLFAVFSAFC-FFYFGYHVHEKAIILVTVPMTVFAIKNPKYHSILI 397

  Fly   380 VLGIAGYFSLFPLLFDADLYIPRYSLYMSYVAMMYGQLYRI--------FPGFRGFHTLEWLYML 436
            .|.....||||||||.....:.:|::.:||..:....|.|:        .|   ..|...|| ::
 Worm   398 HLTCIASFSLFPLLFTPFETLLKYAICVSYFFIQLVFLKRVTLMPLSDLIP---TRHVASWL-LM 458

  Fly   437 GFMAIPLYEHLLSFLLHLDQRLPFLPLLLTSVYSALGVLYFFGAYYLYALG-----ISWGK 492
            |.  :.:|...|...| ...||||.||:..|:.:|:.:....||......|     |.|.|
 Worm   459 GM--VEVYNTFLHKWL-WTSRLPFAPLMAISILTAIELTGLIGALIWSTFGDGIFEIWWAK 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
xitNP_572355.1 Alg6_Alg8 12..478 CDD:281190 193/492 (39%)
algn-8NP_001021940.2 Alg6_Alg8 15..496 CDD:281190 193/490 (39%)
Endonuclease_V 513..753 CDD:143472 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262830663
eggNOG 1 0.900 E1_KOG2576
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 284 1.000 Inparanoid score I1708
Isobase 1 0.950 0.741681 Normalized mean entropy S1324
OMA 1 1.010
OrthoDB 1 1.010 D379099at33208
OrthoFinder 1 1.000 FOG0004496
OrthoInspector 1 1.000 T476167
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12413
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R45
TreeFam 1 0.960
1312.850

Return to query results.
Submit another query.