DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and SPCC16C4.22

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001343092.1 Gene:SPCC16C4.22 / 9406966 PomBaseID:SPCC16C4.22 Length:87 Species:Schizosaccharomyces pombe


Alignment Length:76 Identity:25/76 - (32%)
Similarity:46/76 - (60%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 VLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIA 217
            ||||:|:|:|:|.||:....:..:.||.:.|.|.|:::|...|:...:..:|:.::..|:...:.
pombe     9 VLPLSRVKRIIKQDEDVHYCSNASALLISVATELFVEKLATEAYQLAKLQKRKGIRYRDVEDVVR 73

  Fly   218 NYDQFDFLIDI 228
            ..|||:||.|:
pombe    74 KDDQFEFLSDL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 25/76 (33%)
SPCC16C4.22NP_001343092.1 BUR6 <10..>86 CDD:333362 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.