DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and HAP5

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_015003.1 Gene:HAP5 SGDID:S000005885 Length:242 Species:Saccharomyces cerevisiae

Alignment Length:108 Identity:55/109 (50%)
Similarity:77/109 (71%) Gaps:6/109 (6%)


  Fly   133 FWPNIVSEVHSIGQVDAKHQ------VLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQEL 191
            :|..:::|:.|..:..::||      .||.|||:|:||.||:.|||:.|||::||||||.||.||
Yeast   133 YWQELINEIESTNEPGSEHQDDFKSHSLPFARIRKVMKTDEDVKMISAEAPIIFAKACEIFITEL 197

  Fly   192 TMHAWVHTEESRRRTLQRSDIAQAIANYDQFDFLIDIVPREEI 234
            ||.||...|.::|||||::|||:|:...|.||||||:|||..:
Yeast   198 TMRAWCVAERNKRRTLQKADIAEALQKSDMFDFLIDVVPRRPL 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 40/62 (65%)
HAP5NP_015003.1 HAP5 1..>242 CDD:227533 55/109 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C180120272
eggNOG 1 0.900 E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004229
OrthoInspector 1 1.000 T1136934
orthoMCL 1 0.900 OOG5_128092
Panther 1 1.100 LDO PTHR10252
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4325
TreeFam 1 0.960
87.820

Return to query results.
Submit another query.