DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and DPB3

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_009837.1 Gene:DPB3 SGDID:S000000482 Length:201 Species:Saccharomyces cerevisiae

Alignment Length:112 Identity:32/113 (28%)
Similarity:52/113 (46%) Gaps:15/113 (13%)


  Fly   136 NIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTE 200
            |:|.|         |..|.|::::|||.|.|....:.:..|....|.|.|.|:|.|...:.|..:
Yeast     3 NLVKE---------KAPVFPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLVEESLVLAQ 58

  Fly   201 -ESRRRT---LQRSDIAQAIANYDQFDFLIDIVPREEIKPSSAQKTK 243
             .|:.:|   |..:.|.:.:...|.|.||.|.:  :::|.:||...|
Yeast    59 LNSKGKTSLRLSLNSIEECVEKRDNFRFLEDAI--KQLKKNSALDKK 103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 18/66 (27%)
DPB3NP_009837.1 BUR6 <12..89 CDD:333362 22/77 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4325
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.