DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and NF-YC2

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001077726.1 Gene:NF-YC2 AraportID:AT1G56170 Length:199 Species:Arabidopsis thaliana

Alignment Length:185 Identity:82/186 (44%)
Similarity:114/186 (61%) Gaps:13/186 (7%)


  Fly    69 QQQQQGQQQQQTVPMASLVSNACTLVNPSMSVTVATTVASGAKEKTTKATRTQVARKPPPTIDNF 133
            :|.::||||||...|..:..:|    ..|..|..|:.:|...........:.|..::    :..|
plant     2 EQSEEGQQQQQQGVMDYVPPHA----YQSGPVNAASHMAFQQAHHFHHHHQQQQQQQ----LQMF 58

  Fly   134 WPNIVSEV-HSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWV 197
            |.|.:.|: |:   .|.|:..|||||||||||.||:.:||:.|||::||||||.||.|||:.||:
plant    59 WANQMQEIEHT---TDFKNHTLPLARIKKIMKADEDVRMISAEAPVIFAKACEMFILELTLRAWI 120

  Fly   198 HTEESRRRTLQRSDIAQAIANYDQFDFLIDIVPREEIKPSSAQKTKDGSTSSSSG 252
            ||||::|||||::|||.||:..|.||||:||:||:|:|......|| |:..|..|
plant   121 HTEENKRRTLQKNDIAAAISRTDVFDFLVDIIPRDELKEEGLGVTK-GTIPSVVG 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 44/62 (71%)
NF-YC2NP_001077726.1 CBFD_NFYB_HMF 77..139 CDD:279185 44/62 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124289
orthoMCL 1 0.900 OOG5_128092
Panther 1 1.100 O PTHR10252
Phylome 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.