DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and NF-YC2

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001077726.1 Gene:NF-YC2 / 842070 AraportID:AT1G56170 Length:199 Species:Arabidopsis thaliana


Alignment Length:185 Identity:82/185 - (44%)
Similarity:114/185 - (61%) Gaps:13/185 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QQQQQGQQQQQTVPMASLVSNACTLVNPSMSVTVATTVASGAKEKTTKATRTQVARKPPPTIDNF 133
            :|.::||||||...|..:..:|    ..|..|..|:.:|...........:.|..::    :..|
plant     2 EQSEEGQQQQQQGVMDYVPPHA----YQSGPVNAASHMAFQQAHHFHHHHQQQQQQQ----LQMF 58

  Fly   134 WPNIVSEV-HSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWV 197
            |.|.:.|: |:   .|.|:..|||||||||||.||:.:||:.|||::||||||.||.|||:.||:
plant    59 WANQMQEIEHT---TDFKNHTLPLARIKKIMKADEDVRMISAEAPVIFAKACEMFILELTLRAWI 120

  Fly   198 HTEESRRRTLQRSDIAQAIANYDQFDFLIDIVPREEIKPSSAQKTKDGSTSSSSG 252
            ||||::|||||::|||.||:..|.||||:||:||:|:|......|| |:..|..|
plant   121 HTEENKRRTLQKNDIAAAISRTDVFDFLVDIIPRDELKEEGLGVTK-GTIPSVVG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 65/116 (56%)
NF-YC2NP_001077726.1 HAP5 <58..>157 CDD:227533 61/101 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2401
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001272
OrthoInspector 1 1.000 - - otm2571
orthoMCL 1 0.900 - - OOG6_101766
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X881
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.