DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and NF-YC13

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_199139.1 Gene:NF-YC13 AraportID:AT5G43250 Length:130 Species:Arabidopsis thaliana

Alignment Length:77 Identity:26/78 (33%)
Similarity:42/78 (54%) Gaps:1/78 (1%)


  Fly   155 PLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIANY 219
            |:.|:|||||||::...|..||..:...:.|.|:..|...:.|.|.|.:|:|:....:..|:..:
plant    13 PIGRVKKIMKLDKDINKINSEALHVITYSTELFLHFLAEKSAVVTAEKKRKTVNLDHLRIAVKRH 77

  Fly   220 D-QFDFLIDIVP 230
            . ..|||:|.:|
plant    78 QPTSDFLLDSLP 89

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 21/61 (34%)
NF-YC13NP_199139.1 CBFD_NFYB_HMF 11..74 CDD:279185 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1622159at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.