powered by:
Protein Alignment Nf-YC and NF-YC13
DIOPT Version :9
| Sequence 1: | NP_572354.1 |
Gene: | Nf-YC / 31622 |
FlyBaseID: | FBgn0029905 |
Length: | 601 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_199139.1 |
Gene: | NF-YC13 / 834343 |
AraportID: | AT5G43250 |
Length: | 130 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 77 |
Identity: | 26/77 - (33%) |
| Similarity: | 42/77 - (54%) |
Gaps: | 1/77 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 155 PLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIANY 219
|:.|:|||||||::...|..||..:...:.|.|:..|...:.|.|.|.:|:|:....:..|:..:
plant 13 PIGRVKKIMKLDKDINKINSEALHVITYSTELFLHFLAEKSAVVTAEKKRKTVNLDHLRIAVKRH 77
Fly 220 D-QFDFLIDIVP 230
. ..|||:|.:|
plant 78 QPTSDFLLDSLP 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5208 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1622159at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR10252 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.920 |
|
Return to query results.
Submit another query.