DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and NF-YC13

DIOPT Version :10

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_199139.1 Gene:NF-YC13 / 834343 AraportID:AT5G43250 Length:130 Species:Arabidopsis thaliana


Alignment Length:77 Identity:26/77 - (33%)
Similarity:42/77 - (54%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIANY 219
            |:.|:|||||||::...|..||..:...:.|.|:..|...:.|.|.|.:|:|:....:..|:..:
plant    13 PIGRVKKIMKLDKDINKINSEALHVITYSTELFLHFLAEKSAVVTAEKKRKTVNLDHLRIAVKRH 77

  Fly   220 D-QFDFLIDIVP 230
            . ..|||:|.:|
plant    78 QPTSDFLLDSLP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HFD_NFYC-like 148..230 CDD:467033 25/75 (33%)
NF-YC13NP_199139.1 HFD_POLE4-like 10..88 CDD:467054 25/74 (34%)

Return to query results.
Submit another query.