DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and NF-YC12

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_198630.2 Gene:NF-YC12 AraportID:AT5G38140 Length:195 Species:Arabidopsis thaliana

Alignment Length:122 Identity:48/123 (39%)
Similarity:69/123 (56%) Gaps:19/123 (15%)


  Fly   128 PTIDNFWPN--IVSEVHSIGQVDAKHQV-----------------LPLARIKKIMKLDENAKMIA 173
            |.:|.|..|  ..|::..:..:|...:|                 |||:|::||:|.|...|.|:
plant    23 PMLDQFRSNHPETSKIEGVSSLDTALKVFWNNQREQLGNFAGQTHLPLSRVRKILKSDPEVKKIS 87

  Fly   174 GEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIANYDQFDFLIDIVP 230
            .:.|.||:|||||||.|:|:.||:||:...|.|::|.||.||:.|...:|||||.||
plant    88 CDVPALFSKACEYFILEVTLRAWMHTQSCTRETIRRCDIFQAVKNSGTYDFLIDRVP 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 33/62 (53%)
NF-YC12NP_198630.2 CBFD_NFYB_HMF 68..130 CDD:279185 33/62 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10252
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.