DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and NF-YC12

DIOPT Version :10

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_198630.2 Gene:NF-YC12 / 833794 AraportID:AT5G38140 Length:195 Species:Arabidopsis thaliana


Alignment Length:122 Identity:48/122 - (39%)
Similarity:69/122 - (56%) Gaps:19/122 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PTIDNFWPN--IVSEVHSIGQVDAKHQV-----------------LPLARIKKIMKLDENAKMIA 173
            |.:|.|..|  ..|::..:..:|...:|                 |||:|::||:|.|...|.|:
plant    23 PMLDQFRSNHPETSKIEGVSSLDTALKVFWNNQREQLGNFAGQTHLPLSRVRKILKSDPEVKKIS 87

  Fly   174 GEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIANYDQFDFLIDIVP 230
            .:.|.||:|||||||.|:|:.||:||:...|.|::|.||.||:.|...:|||||.||
plant    88 CDVPALFSKACEYFILEVTLRAWMHTQSCTRETIRRCDIFQAVKNSGTYDFLIDRVP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HFD_NFYC-like 148..230 CDD:467033 41/98 (42%)
NF-YC12NP_198630.2 HFD_NFYC-like 67..144 CDD:467033 39/76 (51%)

Return to query results.
Submit another query.