DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and NF-YC8

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_198143.1 Gene:NF-YC8 AraportID:AT5G27910 Length:187 Species:Arabidopsis thaliana

Alignment Length:132 Identity:55/133 (41%)
Similarity:77/133 (58%) Gaps:12/133 (9%)


  Fly   121 QVARKPPPTIDNFWPNIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACE 185
            |:..|....:.:||...:.     |.:|.|:..||:.|||||||.|.:..|||.|||:|.:||||
plant     9 QLPPKGNEQLKSFWSKEME-----GNLDFKNHDLPITRIKKIMKYDPDVTMIASEAPILLSKACE 68

  Fly   186 YFIQELTMHAWVHTEESRRRTLQRSDIAQAIANYDQFDFLID---IVPREEI----KPSSAQKTK 243
            .||.:|||.:|:|.:||:|.|||:|::..|:|....||||:|   .|.||.:    .|.:.....
plant    69 MFIMDLTMRSWLHAQESKRVTLQKSNVDAAVAQTVIFDFLLDDDIEVKRESVAAAADPVAMPPID 133

  Fly   244 DG 245
            ||
plant   134 DG 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 36/62 (58%)
NF-YC8NP_198143.1 CBFD_NFYB_HMF 37..99 CDD:279185 36/62 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124289
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10252
Phylome 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.