DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and pole4

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001016605.1 Gene:pole4 XenbaseID:XB-GENE-5722002 Length:115 Species:Xenopus tropicalis

Alignment Length:76 Identity:29/77 (38%)
Similarity:48/77 (62%) Gaps:0/77 (0%)


  Fly   150 KHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQ 214
            |...|||:|||.:||.|.:..:.:.|:..:.:||.|.||:.:...|:::.::.:|:||||.|:..
 Frog    35 KQARLPLSRIKALMKADPDLSLASQESVFVISKATELFIETIAKDAYLYAQQGKRKTLQRKDLDN 99

  Fly   215 AIANYDQFDFL 225
            ||...|:|.||
 Frog   100 AIDAIDEFAFL 110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 23/62 (37%)
pole4NP_001016605.1 CBFD_NFYB_HMF 38..101 CDD:279185 23/63 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1622159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.