DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and im:7138239

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_991150.1 Gene:im:7138239 ZFINID:ZDB-GENE-081007-2 Length:316 Species:Danio rerio

Alignment Length:35 Identity:14/36 (39%)
Similarity:19/36 (53%) Gaps:2/36 (6%)


  Fly     8 GTNKAPN--SNATSMFDNTITVTPIKMELGQAYAK 40
            |:..||.  |...:.||:|...||.|:||.|..|:
Zfish   181 GSKGAPEGFSCVPTKFDSTFIETPNKVELIQTVAQ 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185
im:7138239NP_991150.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.