DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and nfyc

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_955933.1 Gene:nfyc ZFINID:ZDB-GENE-030131-2165 Length:360 Species:Danio rerio

Alignment Length:468 Identity:156/469 (33%)
Similarity:208/469 (44%) Gaps:141/469 (30%)


  Fly   129 TIDNFWPNIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTM 193
            ::.:|||.::.|:.::...|.:.|.||||||||||||||:.|||:.|||:|||||.:.||.|||:
Zfish    16 SLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTL 80

  Fly   194 HAWVHTEESRRRTLQRSDIAQAIANYDQFDFLIDIVPREEIKPSSAQKTKDGSTSSSSGMAGAAS 258
            .||:|||:::||||||:|||.||..:||||||||||||:::||...|:                 
Zfish    81 RAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDDLKPPKRQE----------------- 128

  Fly   259 SAASTSNTATSNAAASVAGNATATGNFVASGSTVPATTAGGLKLDTTGATNAAEVLGFSTVNSDI 323
                       ....|||             .|.|                   |..:.|:....
Zfish   129 -----------EVRQSVA-------------PTEP-------------------VQYYFTLAQQP 150

  Fly   324 FSAQLQQQQQQQQQHAAQQQQQQQQQQHHQAHPQQVQIIQQGAGGQQLQYFIALPSQQAAQLVQQ 388
            .:.|:|.|||.||. :|......|..|...|.|||.|:: ||...|||               ||
Zfish   151 SAVQVQGQQQGQQV-SAPTATTLQPGQIIIAQPQQGQVL-QGTTMQQL---------------QQ 198

  Fly   389 PQPAQNHLPINILSTQQPTQQLILTAGPNGQLTATPAPQTTAQ-QQTALLQNLAQQQQQHQQHQ- 451
            .|.||:.                  |.|   :|:.|......: ||..::|..||.|.|.|..| 
Zfish   199 VQVAQSQ------------------ATP---ITSAPVTMQVGEGQQVQIVQAAAQGQAQAQTAQP 242

  Fly   452 --QQIQLLQQVVTPTGELTNVPIAINASHLNLLQRLQ-------MQQQQQ------QQQQQQQQQ 501
              |.:|::||::|.|||:..:|:.:|...|..::..|       :|.|.|      ||..|.:.|
Zfish   243 AGQTMQVMQQIITNTGEIQQIPVQLNTGQLQYIRLAQPVSGTQVVQGQIQTLAANTQQLSQTEVQ 307

  Fly   502 QQQQQVIIPTQLLTTQQLLQLGGAPTVAHQQQQQQQQHANLTQQSNASAVASGTPIFINSTMTGA 566
            |.|||.   .|....|||.|:         ||........|||           |:||.||   .
Zfish   308 QGQQQF---NQFTDGQQLYQI---------QQVTMPAGQELTQ-----------PMFIQST---N 346

  Fly   567 QAAATQAQQQQSA 579
            |.|..|...|.||
Zfish   347 QTADGQVTTQVSA 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 45/62 (73%)
nfycNP_955933.1 CBFD_NFYB_HMF 40..103 CDD:279185 45/63 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C180106828
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004229
OrthoInspector 1 1.000 T1054713
orthoMCL 1 0.900 OOG5_128092
Panther 1 1.100 LDO PTHR10252
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4325
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.