DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and Chrac1

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001128352.1 Gene:Chrac1 RGDID:1309321 Length:128 Species:Rattus norvegicus

Alignment Length:79 Identity:30/80 (38%)
Similarity:44/80 (55%) Gaps:0/80 (0%)


  Fly   154 LPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIAN 218
            |||:||:.|||.......|..||.:|.|||.|.|:|.|...::.|.....::.|..||:|.|..:
  Rat    19 LPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQYLATCSYRHGSGKAKKALTYSDLASAAED 83

  Fly   219 YDQFDFLIDIVPRE 232
            .:...||.||:|::
  Rat    84 SETLQFLADILPKK 97

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 25/62 (40%)
Chrac1NP_001128352.1 H4 18..80 CDD:304892 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1622159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.