DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and Nfyc

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_036998.1 Gene:Nfyc RGDID:3173 Length:335 Species:Rattus norvegicus

Alignment Length:469 Identity:140/470 (30%)
Similarity:192/470 (41%) Gaps:172/470 (37%)


  Fly   129 TIDNFWPNIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTM 193
            ::.:|||.::.|:.::...|.:.|.||||||||||||||:.|||:.|||:|||||.:.||.|||:
  Rat    18 SLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTL 82

  Fly   194 HAWVHTEESRRRTLQRSDIAQAIANYDQFDFLIDIVPREEIKPSSAQKTKDGSTSSSSGMAGAAS 258
            .||:|||:::||||||:|||.||..:||||||||||||:|:||                      
  Rat    83 RAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKP---------------------- 125

  Fly   259 SAASTSNTATSNAAASVAGNATATGNFVASGSTVPATTAGGLKLDTTGATNAAEVLGFSTVNSDI 323
                                                                             
  Rat   126 ----------------------------------------------------------------- 125

  Fly   324 FSAQLQQQQQQQQQHAAQQQQQQQQQQHHQAHPQQVQIIQQGAGGQQLQYFIALPSQQAAQLVQQ 388
                             .::|::.:|....|.|              :||:..|..|..|..||.
  Rat   126 -----------------PKRQEEVRQSVTPAEP--------------VQYYFTLAQQPTAVQVQG 159

  Fly   389 PQPAQNHLPINILSTQQPTQQLILTAGPNGQLTATPAPQTTAQQQTALLQNLAQQQQQHQQHQ-- 451
            .|..|.  ..:..:|.||.|  |:.|.|....|.....|....||..::|  ||.|.|.||.|  
  Rat   160 QQQGQQ--TTSSTTTIQPGQ--IIIAQPQQGQTTPVTMQVGEGQQVQIVQ--AQPQGQAQQAQSG 218

  Fly   452 --QQIQLLQQVVTPTGELTNVPIAINASHLNLLQRLQ-------MQQQQQ------QQQQQQQQQ 501
              |.:|::||::|.|||:..:|:.:||..|..::..|       :|.|.|      ||..|.:.|
  Rat   219 TGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQ 283

  Fly   502 QQQQQVIIPTQLLTTQQLLQLGGAPTVAHQQQQQQQQHANLTQQSNASAVASGTPIFINSTMTGA 566
            |.|||.   :|....|||.|:         ||.......:|.|           |:||.|     
  Rat   284 QGQQQF---SQFTDGQQLYQI---------QQVTMPAGQDLAQ-----------PMFIQS----- 320

  Fly   567 QAAATQAQQQQSAQ 580
               |.|....|:.|
  Rat   321 ---ANQPSDGQTPQ 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 45/62 (73%)
NfycNP_036998.1 CBFD_NFYB_HMF 42..105 CDD:279185 45/63 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C180111263
eggNOG 1 0.900 E1_COG5208
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4000
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004229
OrthoInspector 1 1.000 T1089129
orthoMCL 1 0.900 OOG5_128092
Panther 1 1.100 LDO PTHR10252
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
98.840

Return to query results.
Submit another query.