DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nf-YC and rpoa-49

Sequence 1:NP_572354.1 Gene:Nf-YC FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001293501.1 Gene:rpoa-49 WormBaseID:WBGene00017749 Length:432 Species:Caenorhabditis elegans

Alignment Length:346 Identity:66/347 (19%)
Similarity:119/347 (34%) Gaps:114/347 (33%)


  Fly     4 TNNGGTNKAPNSNATSMFDNTITVTPIKMELGQAYAKSQNSAAMQRRTPNAVVVTS--SSTVSSA 66
            |:|.|::|                 .|||:           .|.||||.|...:..  .:..:|.
 Worm   152 TSNFGSSK-----------------KIKMD-----------EAAQRRTINQETLDEMRKTAFASN 188

  Fly    67 QQQQQQQGQQQQQTVPMASLVSNACTLVNPSMSVTVATTVASGAKEKTTKATRTQVARKPPPTID 131
            ...:.:.|        .|.:.....|::|.:.|..:            ..|.:|:::|...| |.
 Worm   189 SNVKTEDG--------AADVKLENITMMNKAESSIL------------PPAVQTELSRDIYP-IS 232

  Fly   132 NFWPNIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAG--EAPLLF-------AKACEYF 187
            .|..:|        ::||...:     ..::|:..:..|:.||  |...|.       .:|..|.
 Worm   233 LFLEDI--------EIDAIESI-----ATELMEKKKKEKLEAGIPECVTLIMYNEKTKQRAAAYL 284

  Fly   188 IQELTMHAWVHTEESRRRTLQRSDIAQAIANYDQFDFLIDIVPREEIKPSSAQKTKDGSTSSSSG 252
            :  |:....:.|:..::|.|.|.|:::.        .:.||: |::::   ||...|  :::..|
 Worm   285 L--LSTMIEILTKMGKQRQLLRKDLSEL--------KMPDIL-RQKVQ---AQFFND--STNEKG 333

  Fly   253 MAGAASSAASTSNTATSNAAASVAGNATATGNFVASGSTVPATTAGGLKLDTTGATNAA------ 311
            ..|              ..|..:..|.|....|:|....:..|.|...|:..|....|.      
 Worm   334 YTG--------------RGAERIRLNVTDYDRFIAHTLALALTLAPEHKVPITPFQQALSYQPSK 384

  Fly   312 -----EVLGFSTVNSDIFSAQ 327
                 :.||...:..|:.|||
 Worm   385 LEKMFQALGADLIRLDVASAQ 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 CBFD_NFYB_HMF 154..216 CDD:279185 14/71 (20%)
rpoa-49NP_001293501.1 RNA_pol_I_A49 44..426 CDD:284324 66/347 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.