DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14439 and yhjE

DIOPT Version :9

Sequence 1:NP_001188550.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_417980.1 Gene:yhjE / 948032 ECOCYCID:EG12249 Length:440 Species:Escherichia coli


Alignment Length:403 Identity:92/403 - (22%)
Similarity:156/403 - (38%) Gaps:84/403 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 QILAGPTFILIFT---IAGVFMGFAADKYNRVNMLTVCTVIFGIAMILQGTVKEYWQLVILRMIM 161
            |.||  ||.:.|.   |.....|...|:..|...|....:..||:.::.|.:..|..:.|...::
E. coli    65 QSLA--TFAIAFVARPIGSAVFGHFGDRVGRKATLVASLLTMGISTVVIGLLPGYATIGIFAPLL 127

  Fly   162 AA-----------GE-SGCNPLATGIMSDIFPEDKRALVMAIFNWGIYGGY-------GIAFPVG 207
            .|           || .|...|||    :..|..||||         ||.:       |..|..|
E. coli   128 LALARFGQGLGLGGEWGGAALLAT----ENAPPRKRAL---------YGSFPQLGAPIGFFFANG 179

  Fly   208 RY------ITKLNFWNLGWRVCYLGAGVLTVIMAALTGTTLREPERKAIGEGDRQTSSGKPVSLW 266
            .:      :|...|.:.||||.::.:.||.:|...:..:....|..:.:.:..:|........|.
E. coli   180 TFLLLSWLLTDEQFMSWGWRVPFIFSAVLVIIGLYVRVSLHESPVFEKVAKAKKQVKIPLGTLLT 244

  Fly   267 QVIKNPAM-IMLMIAASIRHCGGMTFAYNADLY---YNTYFPDVDLG-------WWLFGVTIGIG 320
            :.::...: ..:|:|.       .|..|...:|   ::|....|.||       |.|....||.|
E. coli   245 KHVRVTVLGTFIMLAT-------YTLFYIMTVYSMTFSTAAAPVGLGLPRNEVLWMLMMAVIGFG 302

  Fly   321 SVGVVVGGIVSDKIVAKMGIRSRAFVLAVSQLIATLPAFGSVYFDPL---------WAMITLGLS 376
             |.|.|.|:::|...     |.::.|:..:.:|    .|....|:||         :|.:.||||
E. coli   303 -VMVPVAGLLADAFG-----RRKSMVIITTLII----LFALFAFNPLLGSGNPILVFAFLLLGLS 357

  Fly   377 YFFAEMWFGIVFAIVVEIVPLRVRSSTIGVFLFVMNNIGGNL-PILVDPVAKILGYRGSIMIFYA 440
              ...:.||.:.|::.|:.|..||.:.......|.:.:|.:: |.:...:....|. |::.::.|
E. coli   358 --LMGLTFGPMGALLPELFPTEVRYTGASFSYNVASILGASVAPYIAAWLQTNYGL-GAVGLYLA 419

  Fly   441 GFYGISSILFFIT 453
            ...|::.|...:|
E. coli   420 AMAGLTLIALLLT 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14439NP_001188550.1 MFS_1 94..416 CDD:284993 84/363 (23%)
MFS 107..452 CDD:119392 87/393 (22%)
yhjENP_417980.1 MFS_ShiA_like 22..431 CDD:340927 91/400 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I432
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.