DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14439 and kgtP

DIOPT Version :9

Sequence 1:NP_001188550.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_417082.1 Gene:kgtP / 947069 ECOCYCID:EG10522 Length:432 Species:Escherichia coli


Alignment Length:414 Identity:98/414 - (23%)
Similarity:157/414 - (37%) Gaps:98/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 AGPTFILIFTIAGVF-------------MGFAADKYNRVN--MLTVCTVIFGIAMI--LQG--TV 148
            :|.|...:...||||             .|..|||:.|..  :|:||.:.||..:|  |.|  |:
E. coli    55 SGNTTTQLLQTAGVFAAGFLMRPIGGWLFGRIADKHGRKKSMLLSVCMMCFGSLVIACLPGYETI 119

  Fly   149 KEYWQ---LVILRM---IMAAGESGCNPLATGIMSDIFPEDKRALVMAIFNWGIYGGYGIAFPVG 207
            .. |.   |::.|:   :...||.|.:  || .||::..|.::....:.....:.||..:|..|.
E. coli   120 GT-WAPALLLLARLFQGLSVGGEYGTS--AT-YMSEVAVEGRKGFYASFQYVTLIGGQLLALLVV 180

  Fly   208 RYI------TKLNFWNLGWRVCYLGAGVLTVIMAALTGTTLREPERKAIGEGDRQTS-----SGK 261
            ..:      ..|..|  |||:.:....||.|:...|         |:.:.|..:|.:     :|.
E. coli   181 VVLQHTMEDAALREW--GWRIPFALGAVLAVVALWL---------RRQLDETSQQETRALKEAGS 234

  Fly   262 PVSLWQVIKNPAMIMLMIAASIRHCGGMTFAYNADLYYNTYFPDVDLGWWLFGVTIGIGSVGVVV 326
            ...||:..:...|::...||     |.:.| |....|...|.  |:.......|..||.:..:.|
E. coli   235 LKGLWRNRRAFIMVLGFTAA-----GSLCF-YTFTTYMQKYL--VNTAGMHANVASGIMTAALFV 291

  Fly   327 G-------GIVSDKIVAKMGIRSRAFVLAVSQLIATLP-------------AFGSVYFDPLWAMI 371
            .       |.:||||    |.|:..........|.|:|             |||.|       |.
E. coli   292 FMLIQPLIGALSDKI----GRRTSMLCFGSLAAIFTVPILSALQNVSSPYAAFGLV-------MC 345

  Fly   372 TLGLSYFFAEMWFGIVFAIVVEIVPLRVRSSTIGVFLFVMNNIGGNLPILVDPVAKILGYRGSIM 436
            .|.:..|:..: .||:.|   |:.|.:||:..:|:...|.|.|.|.....|....|.:|...:  
E. coli   346 ALLIVSFYTSI-SGILKA---EMFPAQVRALGVGLSYAVANAIFGGSAEYVALSLKSIGMETA-- 404

  Fly   437 IFYAGFYGISSILFFITCFLLEGK 460
              :..:..:.:::.|:...:|..|
E. coli   405 --FFWYVTLMAVVAFLVSLMLHRK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14439NP_001188550.1 MFS_1 94..416 CDD:284993 91/368 (25%)
MFS 107..452 CDD:119392 93/400 (23%)
kgtPNP_417082.1 PRK10406 1..432 CDD:182433 98/414 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I432
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.