DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14439 and AT4G08878

DIOPT Version :9

Sequence 1:NP_001188550.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_680668.1 Gene:AT4G08878 / 826464 AraportID:AT4G08878 Length:280 Species:Arabidopsis thaliana


Alignment Length:195 Identity:41/195 - (21%)
Similarity:70/195 - (35%) Gaps:57/195 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 LYYNT-------YFPDVDLGWWLFGVTIGIGSV-------GVVVGGIVSDKIVAKMGIRSRAFVL 347
            :||..       ..||        |:::.:..|       |.:..|.:.||:..|........::
plant    34 IYYQVPGSSSPGSLPD--------GISVAVSGVAFAGTFLGQIFFGCLGDKLGRKRVYGLTLLIM 90

  Fly   348 AVSQLIATLPAFGSVYFDPLWAMITLGLSYFFAEMWFG--------IVFAIVVEIVPLRVRSSTI 404
            .:..:.::| :||.   ||...|:||    .|...|.|        :...|:.|....|.|.:.|
plant    91 TICSIASSL-SFGK---DPKTVMVTL----CFFRFWLGFGIGGDYPLSATIMFEYANKRTRGAFI 147

  Fly   405 GVFLFVMNNIGGNLPILVDPVAKILGYRG-SIMIFYAGFYGISSILFFITCFLLEGKPDEVGQPE 468
             ..:|.|..:|            ||...| |:::.|     :..|.|....::|:|....|.|.:
plant   148 -ASVFAMQGVG------------ILAAGGVSLLVSY-----LFEIEFPSRAYILDGAASTVPQAD 194

  Fly   469  468
            plant   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14439NP_001188550.1 MFS_1 94..416 CDD:284993 29/140 (21%)
MFS 107..452 CDD:119392 37/177 (21%)
AT4G08878NP_680668.1 MFS 13..>172 CDD:119392 35/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.