DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14439 and AT2G18590

DIOPT Version :9

Sequence 1:NP_001188550.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_179449.5 Gene:AT2G18590 / 816374 AraportID:AT2G18590 Length:473 Species:Arabidopsis thaliana


Alignment Length:351 Identity:76/351 - (21%)
Similarity:139/351 - (39%) Gaps:80/351 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 QILAGPTFILIFTIAGVFMGFAADKYNRVNMLTVCTVIFGIAMILQGTVKEYWQLVILRMIMAAG 164
            |.||.|       :||:|    |..|:|..:....:..:..:.:..|..:.:.|:.:.......|
plant    61 QGLASP-------LAGLF----AISYDRPTVFAFGSFFWVSSTVATGVSRYFIQVTLGVAFNGVG 114

  Fly   165 ESGCNPLATGIMSDIFPEDKRALVMAIFNW-GIYGGYGIAFPVGRYITKL----NFWNL-GWRVC 223
            .:...|:...|::|.|.|..|.....::|. |..||.|     |..:..:    :|:.: |||..
plant   115 HAIVYPVLQSIIADSFKESSRGFGFGLWNLIGTVGGIG-----GTVVPTVMAGHDFFGISGWRCA 174

  Fly   224 YLGAGVLTVIMAALTGTTLREPERKAIG--------EGDRQTSSG-----KPVS-----LWQVIK 270
            ::.:..|:.|:..|....:.:|..|...        :.:|..::|     .|.|     .|..||
plant   175 FILSATLSTIVGILVFFFVSDPREKKTSSVIVHHDDQHERDENNGGTMMESPSSSVWKESWVAIK 239

  Fly   271 N-------PAMIMLMIAASIRHCGGMTFAYNADLYYNTYFP----DVDLGWWLFGVTIGIGSVGV 324
            :       ..:::..|..|:        .:||.|::..:|.    |.:....|.|:.....::|.
plant   240 DVTKLRTFQIIVLQGIVGSV--------PWNAMLFWTMWFELIGFDHNQAALLNGIFATGQAIGS 296

  Fly   325 VVGGIVSDKIVAKMGIRSRAFVLAVSQLIATLPAF-GSVYFDPLWAMITLGLSYFFAEM------ 382
            :||||::||:       ||.|..:...:.|....| |:::...|..||...::.|:..:      
plant   297 LVGGIIADKM-------SRVFPNSGRLICAQFSVFMGAMFSIVLLRMIPQSVNSFYIFLVTLFLM 354

  Fly   383 -----WFG--IVFAIVVEIVPLRVRS 401
                 |.|  |...|:.||||.:.|:
plant   355 GLTITWCGPAINSPILAEIVPAKHRT 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14439NP_001188550.1 MFS_1 94..416 CDD:284993 76/351 (22%)
MFS 107..452 CDD:119392 72/344 (21%)
AT2G18590NP_179449.5 MFS 20..406 CDD:119392 76/351 (22%)
MFS_1 31..385 CDD:284993 76/351 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.