DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14439 and CG12490

DIOPT Version :9

Sequence 1:NP_001188550.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_611722.2 Gene:CG12490 / 37623 FlyBaseID:FBgn0034782 Length:479 Species:Drosophila melanogaster


Alignment Length:494 Identity:87/494 - (17%)
Similarity:158/494 - (31%) Gaps:201/494 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ILIF-TIAGVFMGFAADKYNRVNMLTVCTVIFGIAMILQGTVKEYWQLVILRMIMAAGESGCNPL 171
            :||| .|..||:|       |:|:        |::::                .|...|: .|| 
  Fly    19 LLIFLNITTVFIG-------RLNV--------GVSVV----------------AMTNAET-TNP- 50

  Fly   172 ATGIMSDIFP-----EDKRALVMAIFNWGIYGGYGIAFPVGRYITK------LNFWNL------- 218
                   .||     |.:::.:.:.|.|    ||.:...:|.|:.|      :.||.:       
  Fly    51 -------NFPEYDWTEAEKSYIFSSFFW----GYILTQFIGGYLCKRFGVKSVMFWGVFVSGVCS 104

  Fly   219 ----------GWRVCYLGAGVLTVIMAALTGTTL-----------REPERKAIG----------- 251
                      ||: .|.|   :.|:|....|...           ...||..:|           
  Fly   105 ALTPLFIGFGGWQ-AYCG---IRVVMGLAQGLVFPCIHHHLAKWSPPAERNRLGALSHTGMECGN 165

  Fly   252 -----------------EGDRQTSSGKP---VSLWQVIKNPAMI---------MLMIAASIRHCG 287
                             .|....|:|..   .::|.|......:         :..|.:|::|  
  Fly   166 VSAMFLSGMIAKSAIGWPGISYVSAGLAFAWCAIWFVFAADNAVESRYITQEELHYIESSLKH-- 228

  Fly   288 GMTFAYNADLYYNTYFPDVDLGWW---------------LFGVTIGIGSVGVVVGGIVSDKIVAK 337
                  |.| |:.|..|...:..|               .:|::.....:...:.|::.      
  Fly   229 ------NED-YHKTVIPVPWMAIWTSAPFLALTLTRCCATWGLSTLQAQIPTYMNGVLD------ 280

  Fly   338 MGIRSRAFVLAVSQLIATLPAFGSVYF---DPLWA-----MITLGLSYFFAEMW------FGIVF 388
            |.::|.||..|:..|...:.::  ||.   |.|.|     :..|..::.....|      .||.|
  Fly   281 MDMKSNAFFSALPFLAMWIMSY--VYLIIADVLLAGNRLSLTALRKTFNSLAFWIPCATLIGIGF 343

  Fly   389 --------AIVVEIVPLRVRS-STIG--------------VFLFVMNNIGGNLPILVDPVAKILG 430
                    ||.:..:.:.|.| :|||              :.:.::|.....:||:...:..::.
  Fly   344 LDQEQKNLAIALMTISVGVNSGATIGSSLNTIDLSPNHASILMGILNTAVTVVPIVTPLIVGVIV 408

  Fly   431 YRGSIMIFYAGFYGISSILFFI--TCFLLEGKPDEVGQP 467
            :.......:...:.|:::|||:  :.:|..|  ..|.||
  Fly   409 HEDDNRAEWQIVFIIAAVLFFVGNSVYLYFG--TAVSQP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14439NP_001188550.1 MFS_1 94..416 CDD:284993 76/439 (17%)
MFS 107..452 CDD:119392 81/475 (17%)
CG12490NP_611722.2 2A0114euk 14..450 CDD:129972 87/494 (18%)
MFS 54..438 CDD:119392 67/408 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D619250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.