| Sequence 1: | NP_001188550.1 | Gene: | CG14439 / 31614 | FlyBaseID: | FBgn0029898 | Length: | 535 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001034297.2 | Gene: | Spns1 / 361648 | RGDID: | 1305613 | Length: | 528 | Species: | Rattus norvegicus |
| Alignment Length: | 549 | Identity: | 117/549 - (21%) |
|---|---|---|---|
| Similarity: | 205/549 - (37%) | Gaps: | 149/549 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 44 ELDYGD-HACQQNTSMFNRHELPTQCSAVMNETSCYALDFNGTGYCE-WNYNGLGID----YQIL 102
Fly 103 AGPT------FILIFTIAGVFMGFAADKYNRVNMLTVCTVIFGIAMILQGTV----KEYWQLVIL 157
Fly 158 RMIMAAGESGCNPLATGIMSDIFPEDKRALVMAIFNWGIYGGYGIAFPVGRYITKL-NFWNLGWR 221
Fly 222 VCYLGAGVLTVIMAALTGTTLREPERKAIGEGDRQTSSG--KPVSLWQVIK----NPAMIMLMIA 280
Fly 281 ASIRHCGGMTFAYNADLYYNTYFPDVDLGWW------------------------------LFG- 314
Fly 315 VTIGIGSVGVVVGGIVS----------DKIVAKMGIRSRAFVLAVSQLIATLPAFGSVYFDPLWA 369
Fly 370 MITLGLSYFFAEMWFGIVFAIVVEI---VPLRVRSSTIGVFLFVMNNIGGNL--PILVD------ 423
Fly 424 ----PVAKILGYRG---SIMIFYAGFYG-ISSILFFITCFLLEGKPDEVGQPESPKSHPDAVLNA 480
Fly 481 RHMHG--HDNSVFSVDETLPSNGRPAQLP 507 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14439 | NP_001188550.1 | MFS_1 | 94..416 | CDD:284993 | 86/386 (22%) |
| MFS | 107..452 | CDD:119392 | 91/415 (22%) | ||
| Spns1 | NP_001034297.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..38 | 117/549 (21%) | |
| MFS | 62..450 | CDD:119392 | 93/428 (22%) | ||
| MFS_1 | 65..418 | CDD:284993 | 87/393 (22%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1330 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||