DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ASHI and ndufb8

DIOPT Version :8

Sequence 1:NP_001027048.1 Gene:ND-ASHI / 31604 FlyBaseID:FBgn0029888 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_957149.1 Gene:ndufb8 / 393829 ZFINID:ZDB-GENE-040426-1858 Length:188 Species:Danio rerio

Alignment Length:170 Identity:66/171 (39%)
Similarity:96/171 (56%) Gaps:12/171 (7%)


  Fly     1 MSAF---VKTVCLAQKLCAANPVVARQAIRSMAGWNKDYKPGPYPQTEKERLAAAKKYYLLPEEY 62
            |:||   :.|..|.:...::...:.|.| |:.:|.:||..|||||:|.:|:.||||||.:.||:|
Zfish     1 MAAFRAGLLTPALTKGKSSSISAIIRGA-RAASGSSKDSLPGPYPKTAEEKAAAAKKYNMRPEDY 64

  Fly    63 KPYADDGLGYGDYPKLGYGLGVEAKDSYYPWDYPEHKRNQHEPISADHDLYSEDRWSQAEPP--- 124
            :||.|||.|.||||.|. ......:|.||.||:|:.:||..||:....|:|..:|...:..|   
Zfish    65 QPYPDDGWGSGDYPMLP-SRSQHERDPYYQWDHPDLRRNWGEPMHYHFDMYIRNRVDTSPTPLDW 128

  Fly   125 RYSNAYYFACFLGVMSGCLALYYWLDDKKMYRPVAAKQYP 164
            |....:.|. |||:   .:.::...:....|:||||||||
Zfish   129 RTMRLWLFG-FLGL---TMFMFGMGEVLPSYQPVAAKQYP 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-ASHINP_001027048.1 NDUF_B8 25..164 CDD:283478 59/142 (42%)
ndufb8NP_957149.1 NDUF_B8 22..188 CDD:283478 61/150 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161129041
eggNOG 1 0.900 E1_KOG4040
Hieranoid 1 1.000
Homologene 1 1.000 H3668
Inparanoid 1 1.050 106 1.000 Inparanoid score I4825
OMA 1 1.010
OrthoDB 1 1.010 D1427659at2759
OrthoFinder 1 1.000 FOG0006372
OrthoInspector 1 1.000 T1054719
orthoMCL 1 0.900 OOG5_133612
Panther 1 1.100 LDO PTHR12840
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4440
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.