DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-ASHI and Ndufb8

DIOPT Version :8

Sequence 1:NP_001027048.1 Gene:ND-ASHI / 31604 FlyBaseID:FBgn0029888 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001099830.1 Gene:Ndufb8 / 293991 RGDID:1309129 Length:186 Species:Rattus norvegicus

Alignment Length:152 Identity:59/153 (39%)
Similarity:81/153 (53%) Gaps:18/153 (12%)


  Fly    19 PVVARQAIRSMAGWNKDYKPGPYPQTEKERLAAAKKYYLLPEEYKPYADDGLGYGDYPKLGYGLG 83
            |:.||:|..    ..||..||.||:|.:||.||||||.:..|:|:||.|||:||||||.|. ...
  Rat    23 PLEARRAFH----MTKDMMPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLP-NRS 82

  Fly    84 VEAKDSYYPWDYPEHKRNQHEPISADHDLYSEDRWSQAEPP-----RYSNAYYFACFLGVMSGCL 143
            ...:|.:|.||:|:.:.|..|||..|.|:|..:|...:..|     ...:.:.|..|:..|    
  Rat    83 QHERDPWYEWDHPDLRLNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCRHLFGFVAFMVFM---- 143

  Fly   144 ALYYWLDDK-KMYRPVAAKQYP 164
               :|:.|. ..|:||..||||
  Rat   144 ---FWVGDMFPSYQPVGPKQYP 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-ASHINP_001027048.1 NDUF_B8 25..164 CDD:283478 55/145 (38%)
Ndufb8NP_001099830.1 NDUF_B8 21..186 CDD:283478 59/153 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161127632
eggNOG 1 0.900 E1_KOG4040
Hieranoid 1 1.000
Homologene 1 1.000 H3668
Inparanoid 1 1.050 102 1.000 Inparanoid score I4800
OMA 1 1.010
OrthoDB 1 1.010 D1427659at2759
OrthoFinder 1 1.000 FOG0006372
OrthoInspector 1 1.000 T1089133
orthoMCL 1 0.900 OOG5_133612
Panther 1 1.100 LDO PTHR12840
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.