DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and CTR1

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_015449.1 Gene:CTR1 / 856241 SGDID:S000006328 Length:406 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:48/233 - (20%)
Similarity:90/233 - (38%) Gaps:57/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGMEHMMPMAFHF 85
            ||....|..|.::||..          .|||  :|.:|.:...:.::...||..|:..|.|.::.
Yeast    79 GMSMSMSSTPTSSASAQ----------TTSD--SSMSGMSGMSSSDNSSSSGMDMDMSMGMNYYL 131

  Fly    86 G---YNETILFSWWHIETVAGLIGSMIAIFLL----ALMYEGLKYYR---EYLFWKTYNLLEYRP 140
            .   .|..:||...|    |...|....||||    |.:|:.|.:..   |..::|.:: .:.:.
Yeast   132 TPTYKNYPVLFHHLH----ANNSGKAFGIFLLFVVAAFVYKLLLFVSWCLEVHWFKKWD-KQNKY 191

  Fly   141 VTGPQRNPE----------------APRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINH-LLQTL 188
            .|.|..|.:                .|::|:          .:.::.   .||::.:.| :::..
Yeast   192 STLPSANSKDEGKHYDTENNFEIQGLPKLPN----------LLSDIF---VPSLMDLFHDIIRAF 243

  Fly   189 LHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLF 226
            |......:.::|||..|::.:.....|:.|.|:....|
Yeast   244 LVFTSTMIIYMLMLATMSFVLTYVFAVITGLALSEVFF 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 33/173 (19%)
CTR1NP_015449.1 Ctr 130..281 CDD:398012 31/168 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.