DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and CTR3

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_013515.3 Gene:CTR3 SGDID:S000004403 Length:241 Species:Saccharomyces cerevisiae

Alignment Length:230 Identity:50/231 (22%)
Similarity:85/231 (37%) Gaps:84/231 (36%)


  Fly    66 NHGGGSGTGMEHMMPMAFHFGYNETILFSW-----------WHIETVAGLIGSMIAIFLLALMYE 119
            |.||.|.|..:...       ...::|::|           |..:|.....||.|..|.|.::.:
Yeast     2 NMGGSSSTAAKKAT-------CKISMLWNWYTIDTCFIARSWRNDTKGKFAGSCIGCFALVVVAQ 59

  Fly   120 GLKYY----------------------REYLF----------------------WKTYNLLEYRP 140
            .|..:                      .||:.                      ||| .|:..:.
Yeast    60 WLTRFSRQFDVELLKRQKIKHLASYSPEEYVVKCGEEDAKSDIEELQGFYNEPSWKT-TLISLQK 123

  Fly   141 -------VTGPQR--NPEAPRIPSPAAAAP--SPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQV 194
                   |.||:|  .||...:....:...  :||...        |:.|  :|:::..:.|||.
Yeast   124 SFIYSFYVWGPRRLNEPEDDLLKKVLSCCTLITPVDLY--------PTFL--DHMIRVTIFVLQW 178

  Fly   195 TLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWK 229
            .||:::||:||.||.::.:..::||.||.|:||::
Yeast   179 GLSYIIMLLFMYYNGYIIISCLIGAIVGRFIFCYE 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 43/213 (20%)
CTR3NP_013515.3 Ctr 18..210 CDD:282057 43/203 (21%)
DUF2935 <144..170 CDD:288057 5/36 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.810

Return to query results.
Submit another query.