DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and CTR3

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_013515.3 Gene:CTR3 / 851129 SGDID:S000004403 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:50/230 - (21%)
Similarity:85/230 - (36%) Gaps:84/230 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NHGGGSGTGMEHMMPMAFHFGYNETILFSW-----------WHIETVAGLIGSMIAIFLLALMYE 119
            |.||.|.|..:...       ...::|::|           |..:|.....||.|..|.|.::.:
Yeast     2 NMGGSSSTAAKKAT-------CKISMLWNWYTIDTCFIARSWRNDTKGKFAGSCIGCFALVVVAQ 59

  Fly   120 GLKYY----------------------REYLF----------------------WKTYNLLEYRP 140
            .|..:                      .||:.                      ||| .|:..:.
Yeast    60 WLTRFSRQFDVELLKRQKIKHLASYSPEEYVVKCGEEDAKSDIEELQGFYNEPSWKT-TLISLQK 123

  Fly   141 -------VTGPQR--NPEAPRIPSPAAAAP--SPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQV 194
                   |.||:|  .||...:....:...  :||...        |:.|  :|:::..:.|||.
Yeast   124 SFIYSFYVWGPRRLNEPEDDLLKKVLSCCTLITPVDLY--------PTFL--DHMIRVTIFVLQW 178

  Fly   195 TLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWK 229
            .||:::||:||.||.::.:..::||.||.|:||::
Yeast   179 GLSYIIMLLFMYYNGYIIISCLIGAIVGRFIFCYE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 43/212 (20%)
CTR3NP_013515.3 Ctr 20..210 CDD:398012 43/200 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102787
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.720

Return to query results.
Submit another query.