DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and COPT3

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_200712.1 Gene:COPT3 AraportID:AT5G59040 Length:151 Species:Arabidopsis thaliana

Alignment Length:182 Identity:37/183 (20%)
Similarity:64/183 (35%) Gaps:60/183 (33%)


  Fly    65 HNHGGGSGTGMEHMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLF 129
            |.|||        ||.|.|.:|....:||..|...::......:..||:::...|.|        
plant    24 HRHGG--------MMHMTFFWGKTTEVLFDGWPGTSLKMYWVCLAVIFVISAFSECL-------- 72

  Fly   130 WKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQV 194
                                            |...::     |..|:.|. ..||||.::.::.
plant    73 --------------------------------SRCGFM-----KSGPASLG-GGLLQTAVYTVRA 99

  Fly   195 TLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLF------CWKKSVIVDVTEHC 240
            .||:|:||..|::|..:.:..:.|..:|:.:|      ....:...:|..||
plant   100 ALSYLVMLAVMSFNGGVFVAAMAGFGLGFMIFGSRAFRATSSNSHTEVQSHC 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 28/147 (19%)
COPT3NP_200712.1 Ctr 30..131 CDD:282057 28/147 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoInspector 1 1.000 T124291
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.