DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and COPT3

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_200712.1 Gene:COPT3 / 836021 AraportID:AT5G59040 Length:151 Species:Arabidopsis thaliana


Alignment Length:182 Identity:37/182 - (20%)
Similarity:64/182 - (35%) Gaps:60/182 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 HNHGGGSGTGMEHMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLF 129
            |.|||        ||.|.|.:|....:||..|...::......:..||:::...|.|        
plant    24 HRHGG--------MMHMTFFWGKTTEVLFDGWPGTSLKMYWVCLAVIFVISAFSECL-------- 72

  Fly   130 WKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQV 194
                                            |...::     |..|:.|. ..||||.::.::.
plant    73 --------------------------------SRCGFM-----KSGPASLG-GGLLQTAVYTVRA 99

  Fly   195 TLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLF------CWKKSVIVDVTEHC 240
            .||:|:||..|::|..:.:..:.|..:|:.:|      ....:...:|..||
plant   100 ALSYLVMLAVMSFNGGVFVAAMAGFGLGFMIFGSRAFRATSSNSHTEVQSHC 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 28/146 (19%)
COPT3NP_200712.1 Ctr 30..131 CDD:282057 28/146 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102787
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.