DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and COPT1

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_200711.1 Gene:COPT1 AraportID:AT5G59030 Length:170 Species:Arabidopsis thaliana

Alignment Length:214 Identity:58/215 (27%)
Similarity:91/215 (42%) Gaps:70/215 (33%)


  Fly    15 MHHDHVGMHHDHSGIP-AATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGMEHM 78
            |.|||  ||    |:| .:::|....:||.:                 :|:.|.|||. ..|:.|
plant     1 MDHDH--MH----GMPRPSSSSSSSPSSMMN-----------------NGSMNEGGGH-HHMKMM 41

  Fly    79 MPMAFHFGYNETILFSWWHIETVAGLIG-SMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPVT 142
            |.|.|.:|.|..:|||.|. .|.:|:.. .:|.:|.||::.|          |..::.| .|..|
plant    42 MHMTFFWGKNTEVLFSGWP-GTSSGMYALCLIFVFFLAVLTE----------WLAHSSL-LRGST 94

  Fly   143 GPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFMTY 207
            |...|..|                                .|:||.::.|::.|::|:||..|::
plant    95 GDSANRAA--------------------------------GLIQTAVYTLRIGLAYLVMLAVMSF 127

  Fly   208 NVWLCLMVVLGAAVGYFLF 226
            |..:.|:.:.|.|||:.||
plant   128 NAGVFLVALAGHAVGFMLF 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 39/148 (26%)
COPT1NP_200711.1 Ctr 45..146 CDD:282057 37/145 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 O PTHR12483
Phylome 1 0.910 0.714 Consistency score
54.920

Return to query results.
Submit another query.