DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and COPT2

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_190274.1 Gene:COPT2 AraportID:AT3G46900 Length:158 Species:Arabidopsis thaliana

Alignment Length:213 Identity:52/214 (24%)
Similarity:78/214 (36%) Gaps:82/214 (38%)


  Fly    15 MHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGMEHMM 79
            |.|||:   ||                    :|..|...:|.:.|.            |....||
plant     1 MDHDHM---HD--------------------MPPPSPSSSSMSNHT------------TPHMMMM 30

  Fly    80 PMAFHFGYNETILFSWWHIETVAGLIG-SMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPVTG 143
            .|.|.:|.|..:|||.|. .|.:|:.. .:|.|||||::.|.|                      
plant    31 HMTFFWGKNTEVLFSGWP-GTSSGMYALCLIVIFLLAVIAEWL---------------------- 72

  Fly   144 PQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFMTYN 208
                            |.||:..|....::..       .|.||.::.|:..||:|:||..|::|
plant    73 ----------------AHSPILRVSGSTNRAA-------GLAQTAVYTLKTGLSYLVMLAVMSFN 114

  Fly   209 VWLCLMVVLGAAVGYFLF 226
            ..:.::.:.|..||:|||
plant   115 AGVFIVAIAGYGVGFFLF 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 39/148 (26%)
COPT2NP_190274.1 Ctr 34..132 CDD:282057 37/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 O PTHR12483
Phylome 1 0.910 0.667 Consistency score
54.920

Return to query results.
Submit another query.