DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and COPT6

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_850091.1 Gene:COPT6 AraportID:AT2G26975 Length:145 Species:Arabidopsis thaliana

Alignment Length:202 Identity:43/203 (21%)
Similarity:75/203 (37%) Gaps:76/203 (37%)


  Fly    25 DHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGMEHMMPMAFHFGYNE 89
            ||..:|.::.|.|...:..::|                               ||.|.|.:|.|.
plant     2 DHGNMPPSSPSSMVNHTNSNMI-------------------------------MMHMTFFWGKNT 35

  Fly    90 TILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPVTGPQRNPEAPRIP 154
            .||||.|...::...:..:|.:||||::.|.|.:         .::|..|..|...:.       
plant    36 EILFSGWPGTSLGMYVLCLIVVFLLAVIVEWLAH---------SSILRGRGSTSRAKG------- 84

  Fly   155 SPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGA 219
                                         |:||.::.|:..|::|:||..|::|..:.::.:.|.
plant    85 -----------------------------LVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGF 120

  Fly   220 AVGYFLF 226
            |||:.||
plant   121 AVGFMLF 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 35/147 (24%)
COPT6NP_850091.1 Ctr 25..127 CDD:282057 35/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.