DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and slc31a2

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_002937270.1 Gene:slc31a2 XenbaseID:XB-GENE-5805083 Length:175 Species:Xenopus tropicalis

Alignment Length:168 Identity:57/169 (34%)
Similarity:84/169 (50%) Gaps:28/169 (17%)


  Fly    79 MPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLL------- 136
            |.|.|.|..|.|:||.:|.::|:||||.|.:.:.||.::||..|      .||: |||       
 Frog     1 MQMYFVFSENVTLLFDFWTVQTLAGLILSCVVVLLLTVLYEVSK------VWKS-NLLGQALQTF 58

  Fly   137 ----EYRPVTGPQRNPEA-------PRIPSPAAAAPSPVQYVGEVVHKQPPSMLS---INHLLQT 187
                .:.|......:|||       |.:||.:.:.....:....:|.:..||..|   ..|...:
 Frog    59 PIRSTHEPTPSSTPDPEASSSIVCDPLLPSASLSHQHVERLPPVIVERTQPSSNSRWWFLHSFLS 123

  Fly   188 LLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFL 225
            |||:.||.|.::|||..|:||..:.:.||||:.:||||
 Frog   124 LLHMSQVVLGYMLMLCVMSYNAAIFIAVVLGSGLGYFL 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 57/169 (34%)
slc31a2XP_002937270.1 Ctr <114..161 CDD:282057 20/47 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120570
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.