DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and K12C11.6

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001076607.1 Gene:K12C11.6 WormBaseID:WBGene00045052 Length:132 Species:Caenorhabditis elegans

Alignment Length:165 Identity:41/166 (25%)
Similarity:69/166 (42%) Gaps:52/166 (31%)


  Fly    71 SGTGMEHMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNL 135
            ||....||.   ||....:|:||..|::.....::.....|.:..::.|.:|:.|    ||.   
 Worm     4 SGPPFMHMW---FHTKTQDTVLFKTWNVTDTPTMVWVCCIIVVAGILLELIKFLR----WKI--- 58

  Fly   136 LEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSIN---------HLLQTLLHV 191
                                             |..||....::|.:         |:.||:|.:
 Worm    59 ---------------------------------EKWHKNRDELVSRSYISRLFSPIHIGQTILFM 90

  Fly   192 LQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLF 226
            :|::.|::|||:|||::|||.:.||:|..:||..|
 Worm    91 VQLSFSYILMLLFMTFSVWLGIAVVVGLGIGYLAF 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 36/156 (23%)
K12C11.6NP_001076607.1 Ctr 9..125 CDD:282057 38/159 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D564753at33208
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.