DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and K12C11.7

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001076608.1 Gene:K12C11.7 WormBaseID:WBGene00045053 Length:166 Species:Caenorhabditis elegans

Alignment Length:157 Identity:51/158 (32%)
Similarity:73/158 (46%) Gaps:18/158 (11%)


  Fly    75 MEHMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYR 139
            |..||.|.|||...|.|||..|......|.:.|.|::|.:|...|.||:.|:.:   |..:.|..
 Worm     2 MMDMMQMYFHFRIQEPILFRQWKPTDTTGYVFSCISLFFIAFCLELLKFGRQRM---TRTVKEKL 63

  Fly   140 PV----TGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSIN---HLLQTLLHVLQVTLS 197
            .|    :.|:...|.|..|.|:..        |::....|.:|.||:   |...:.|..||..:.
 Worm    64 AVDCCCSTPEGIWEIPEEPEPSPR--------GKLASLAPFTMESISSWRHFASSFLFFLQNFVD 120

  Fly   198 FLLMLIFMTYNVWLCLMVVLGAAVGYF 224
            :.|||:.||||..|...::.|.|:|||
 Worm   121 YSLMLVAMTYNYPLFFSLLAGHAIGYF 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 49/154 (32%)
K12C11.7NP_001076608.1 Ctr 9..148 CDD:282057 47/151 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.960

Return to query results.
Submit another query.