DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and Ctr1B

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_649790.1 Gene:Ctr1B FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster

Alignment Length:177 Identity:64/178 (36%)
Similarity:97/178 (54%) Gaps:7/178 (4%)


  Fly    66 NHGGGSGTGMEHMMP--MAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYL 128
            :||....|......|  |.||.|:.|.||:..|...||...:.|.:||||::.:||.||:.|:.|
  Fly     2 DHGSDDSTSTAKSCPMIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQL 66

  Fly   129 FWKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQ 193
            ..:.......:.....:|..|||  .:....:.:|:....|..:.|  .:.:.:|::|:||::||
  Fly    67 ARREARRASEQLAAEQRRKNEAP--AAGGCCSEAPLAEPREQTYWQ--RLFASSHIVQSLLNLLQ 127

  Fly   194 VTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHC 240
            :.:|:||||||||:|.||||.|:||..:|||.|.|.|. ..|.:|.|
  Fly   128 IVISYLLMLIFMTFNYWLCLAVILGLGLGYFFFGWNKK-NPDESECC 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 55/149 (37%)
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 54/147 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130816903
eggNOG 1 0.900 E1_KOG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I2475
Isobase 1 0.950 0 Normalized mean entropy S2329
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12483
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4018
87.970

Return to query results.
Submit another query.