DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and slc31a1

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001001238.1 Gene:slc31a1 / 407919 XenbaseID:XB-GENE-994882 Length:183 Species:Xenopus tropicalis


Alignment Length:248 Identity:97/248 - (39%)
Similarity:122/248 - (49%) Gaps:72/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHAHHSAPGVDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAH 65
            |||:||:....|     .|.|.||                      |.||      ..|..||  
 Frog     1 MDHSHHTVTTSD-----PHGGHHH----------------------PTTS------GNHGDHG-- 30

  Fly    66 NHGGGSGTGMEHMMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLF 129
                    |..|||.|.|:||| |..:||:...|.:...:.|:.:|:|||||:|||||..||.|.
 Frog    31 --------GSMHMMQMTFYFGYENVEVLFTGLVINSAGEMAGAFVAVFLLALLYEGLKISREALL 87

  Fly   130 WKTYNLLEYR--PVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVV---HKQ-PPSMLSINHLLQTL 188
            .|:...:.|.  ||.||.                      |.::   ||. ...|||:.||||||
 Frog    88 RKSQVSIRYNSMPVPGPN----------------------GTILMETHKTVGQRMLSVPHLLQTL 130

  Fly   189 LHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHCH 241
            ||::||.:|:.|||||||||.:||:.|..||..|||||.|||:|:||:|||||
 Frog   131 LHIIQVVVSYFLMLIFMTYNAYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 65/153 (42%)
slc31a1NP_001001238.1 Ctr 38..168 CDD:309321 64/151 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7197
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4548
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - otm47693
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3487
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.