DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and slc31a1

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001001238.1 Gene:slc31a1 XenbaseID:XB-GENE-994882 Length:183 Species:Xenopus tropicalis

Alignment Length:248 Identity:97/249 (39%)
Similarity:122/249 (49%) Gaps:72/249 (29%)


  Fly     1 MDHAHHSAPGVDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAH 65
            |||:||:....|     .|.|.||                      |.||      ..|..||  
 Frog     1 MDHSHHTVTTSD-----PHGGHHH----------------------PTTS------GNHGDHG-- 30

  Fly    66 NHGGGSGTGMEHMMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLF 129
                    |..|||.|.|:||| |..:||:...|.:...:.|:.:|:|||||:|||||..||.|.
 Frog    31 --------GSMHMMQMTFYFGYENVEVLFTGLVINSAGEMAGAFVAVFLLALLYEGLKISREALL 87

  Fly   130 WKTYNLLEYR--PVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVV---HKQ-PPSMLSINHLLQTL 188
            .|:...:.|.  ||.||.                      |.::   ||. ...|||:.||||||
 Frog    88 RKSQVSIRYNSMPVPGPN----------------------GTILMETHKTVGQRMLSVPHLLQTL 130

  Fly   189 LHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHCH 241
            ||::||.:|:.|||||||||.:||:.|..||..|||||.|||:|:||:|||||
 Frog   131 LHIIQVVVSYFLMLIFMTYNAYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 66/154 (43%)
slc31a1NP_001001238.1 Ctr 38..168 CDD:309321 65/152 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.770

Return to query results.
Submit another query.