DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and slc31a1

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_991280.3 Gene:slc31a1 / 403028 ZFINID:ZDB-GENE-040415-3 Length:188 Species:Danio rerio


Alignment Length:236 Identity:89/236 - (37%)
Similarity:121/236 - (51%) Gaps:53/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGM 75
            :|.|..|.||    :.:.:|:               |.:.|    |.||.....:.||       
Zfish     1 MDSSHSHHHV----EETTMPS---------------PASDD----HGGHLTTSGNGHG------- 35

  Fly    76 EH--MMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLE 137
            :|  ||.|.|:||| |..:||:...|.|...:.|:.|.:||||::|||||..||.|..:....:.
Zfish    36 DHMMMMQMTFYFGYKNVELLFAGLVINTPGEMAGACIGVFLLAVLYEGLKIGREVLLRRNQVNVR 100

  Fly   138 YR--PVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLL 200
            |.  ||.|           |.........:.||:       .|||:.|.||||||::||.:|:.|
Zfish   101 YNSMPVPG-----------SDGTVLMETHKTVGQ-------RMLSMAHFLQTLLHIIQVVVSYFL 147

  Fly   201 MLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHCH 241
            ||:|||||.:||:.|..||.:|||||.|||:|:||:|||||
Zfish   148 MLVFMTYNGYLCIAVAAGAGLGYFLFSWKKAVVVDITEHCH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 81..226 CDD:461194 60/147 (41%)
slc31a1NP_991280.3 None


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 - -
eggNOG 1 0.900 - -
Hieranoid 1 1.000 - -