DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and slc31a1

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001307334.1 Gene:slc31a1 ZFINID:ZDB-GENE-040415-3 Length:188 Species:Danio rerio

Alignment Length:246 Identity:89/247 (36%)
Similarity:121/247 (49%) Gaps:65/247 (26%)


  Fly     1 MDHAHHSAPGVDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAH 65
            |.|:||                |.:.:.:|:               |.:.|    |.||.....:
Zfish     3 MSHSHH----------------HVEETTMPS---------------PASDD----HGGHLTTSGN 32

  Fly    66 NHGGGSGTGMEH--MMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREY 127
            .||       :|  ||.|.|:||| |..:||:...|.|...:.|:.|.:||||::|||||..||.
Zfish    33 GHG-------DHMMMMQMTFYFGYKNVELLFAGLVINTPGEMAGACIGVFLLAVLYEGLKIGREV 90

  Fly   128 LFWKTYNLLEYR--PVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLH 190
            |..:....:.|.  ||.|           |.........:.||:       .|||:.|.||||||
Zfish    91 LLRRNQVNVRYNSMPVPG-----------SDGTVLMETHKTVGQ-------RMLSMAHFLQTLLH 137

  Fly   191 VLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHCH 241
            ::||.:|:.|||:|||||.:||:.|..||.:|||||.|||:|:||:|||||
Zfish   138 IIQVVVSYFLMLVFMTYNGYLCIAVAAGAGLGYFLFSWKKAVVVDITEHCH 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 62/150 (41%)
slc31a1NP_001307334.1 Ctr 41..173 CDD:282057 62/150 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 1 1.000
Homologene 1 1.000 H1399
Inparanoid 1 1.050 141 1.000 Inparanoid score I4400
OMA 1 1.010
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 1 1.000 T1051833
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 LDO PTHR12483
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4018
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.