DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and slc31a1

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001307334.1 Gene:slc31a1 / 403028 ZFINID:ZDB-GENE-040415-3 Length:188 Species:Danio rerio


Alignment Length:246 Identity:89/246 - (36%)
Similarity:121/246 - (49%) Gaps:65/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHAHHSAPGVDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAH 65
            |.|:||                |.:.:.:|:               |.:.|    |.||.....:
Zfish     3 MSHSHH----------------HVEETTMPS---------------PASDD----HGGHLTTSGN 32

  Fly    66 NHGGGSGTGMEH--MMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREY 127
            .||       :|  ||.|.|:||| |..:||:...|.|...:.|:.|.:||||::|||||..||.
Zfish    33 GHG-------DHMMMMQMTFYFGYKNVELLFAGLVINTPGEMAGACIGVFLLAVLYEGLKIGREV 90

  Fly   128 LFWKTYNLLEYR--PVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLH 190
            |..:....:.|.  ||.|           |.........:.||:       .|||:.|.||||||
Zfish    91 LLRRNQVNVRYNSMPVPG-----------SDGTVLMETHKTVGQ-------RMLSMAHFLQTLLH 137

  Fly   191 VLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHCH 241
            ::||.:|:.|||:|||||.:||:.|..||.:|||||.|||:|:||:|||||
Zfish   138 IIQVVVSYFLMLVFMTYNGYLCIAVAAGAGLGYFLFSWKKAVVVDITEHCH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 61/149 (41%)
slc31a1NP_001307334.1 Ctr 41..173 CDD:282057 61/149 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I6967
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1399
Inparanoid 1 1.050 139 1.000 Inparanoid score I4497
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - oto41049
orthoMCL 1 0.900 - - OOG6_102787
Panther 1 1.100 - - LDO PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 1 1.000 - - X3487
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.