DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and chca-1

DIOPT Version :10

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001023247.1 Gene:chca-1 / 3565521 WormBaseID:WBGene00044107 Length:156 Species:Caenorhabditis elegans


Alignment Length:151 Identity:37/151 - (24%)
Similarity:70/151 - (46%) Gaps:22/151 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPV 141
            |.|.|.:|....:|:||..|.:.....::.:...:....::.|.|||.|    |.|...::.   
 Worm    19 HRMWMWYHVDVEDTVLFKSWTVFDAGTMVWTCFVVAAAGILLEALKYAR----WATEERMKI--- 76

  Fly   142 TGPQRNPEAPRIPSPAAAAPSPVQYVG-EVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFM 205
              .|.|.:            |..:|.| ::..|.........|::.:|.|..|:.|:::||.::|
 Worm    77 --DQENVD------------SKTKYGGIKIPGKSEKYNFWKRHIIDSLYHFWQLLLAYILMNVYM 127

  Fly   206 TYNVWLCLMVVLGAAVGYFLF 226
            .::|::||.:..|.|:|:|:|
 Worm   128 VFSVYICLSLCFGLAIGHFVF 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 81..226 CDD:461194 34/145 (23%)
chca-1NP_001023247.1 Ctr 23..148 CDD:461194 34/145 (23%)

Return to query results.
Submit another query.