DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and F58G6.9

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001023247.1 Gene:F58G6.9 WormBaseID:WBGene00044107 Length:156 Species:Caenorhabditis elegans

Alignment Length:151 Identity:37/152 (24%)
Similarity:70/152 (46%) Gaps:22/152 (14%)


  Fly    77 HMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPV 141
            |.|.|.:|....:|:||..|.:.....::.:...:....::.|.|||.|    |.|...::.   
 Worm    19 HRMWMWYHVDVEDTVLFKSWTVFDAGTMVWTCFVVAAAGILLEALKYAR----WATEERMKI--- 76

  Fly   142 TGPQRNPEAPRIPSPAAAAPSPVQYVG-EVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFM 205
              .|.|.:            |..:|.| ::..|.........|::.:|.|..|:.|:::||.::|
 Worm    77 --DQENVD------------SKTKYGGIKIPGKSEKYNFWKRHIIDSLYHFWQLLLAYILMNVYM 127

  Fly   206 TYNVWLCLMVVLGAAVGYFLF 226
            .::|::||.:..|.|:|:|:|
 Worm   128 VFSVYICLSLCFGLAIGHFVF 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 35/148 (24%)
F58G6.9NP_001023247.1 Ctr 21..148 CDD:282057 35/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.