DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and F58G6.9

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001023247.1 Gene:F58G6.9 / 3565521 WormBaseID:WBGene00044107 Length:156 Species:Caenorhabditis elegans


Alignment Length:151 Identity:37/151 - (24%)
Similarity:70/151 - (46%) Gaps:22/151 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPV 141
            |.|.|.:|....:|:||..|.:.....::.:...:....::.|.|||.|    |.|...::.   
 Worm    19 HRMWMWYHVDVEDTVLFKSWTVFDAGTMVWTCFVVAAAGILLEALKYAR----WATEERMKI--- 76

  Fly   142 TGPQRNPEAPRIPSPAAAAPSPVQYVG-EVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFM 205
              .|.|.:            |..:|.| ::..|.........|::.:|.|..|:.|:::||.::|
 Worm    77 --DQENVD------------SKTKYGGIKIPGKSEKYNFWKRHIIDSLYHFWQLLLAYILMNVYM 127

  Fly   206 TYNVWLCLMVVLGAAVGYFLF 226
            .::|::||.:..|.|:|:|:|
 Worm   128 VFSVYICLSLCFGLAIGHFVF 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 35/147 (24%)
F58G6.9NP_001023247.1 Ctr 21..148 CDD:282057 35/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.