DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and ctr6

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_595861.1 Gene:ctr6 / 2540641 PomBaseID:SPBC23G7.16 Length:148 Species:Schizosaccharomyces pombe


Alignment Length:163 Identity:48/163 - (29%)
Similarity:73/163 - (44%) Gaps:36/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NHGGGSGTGMEH-MMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYY---R 125
            ||||.|  .|.| .|.|.|:..| |..|:|..|||..::..:.|::||.:|..::|.|:.:   :
pombe     2 NHGGNS--TMRHCSMKMTFNTDYDNLCIVFKSWHIGNLSQFLLSLLAIAILGYLFERLRSFTSLK 64

  Fly   126 EYLFWKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLH 190
            |..|.:.|        .|.|..                    |.:.| ...|:.|........|:
pombe    65 ETEFQRGY--------AGQQSE--------------------GLLTH-HSKSLKSGRPFRLCALY 100

  Fly   191 VLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGY 223
            .:|:..|:.|||:.||||.::.|.:.:|||.||
pombe   101 AVQLVFSYFLMLVAMTYNAYVILAIAIGAAFGY 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 41/149 (28%)
ctr6NP_595861.1 Ctr 14..133 CDD:282057 39/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2023
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102787
Panther 1 1.100 - - LDO PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.850

Return to query results.
Submit another query.