DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and ctr6

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_595861.1 Gene:ctr6 PomBaseID:SPBC23G7.16 Length:148 Species:Schizosaccharomyces pombe

Alignment Length:163 Identity:48/164 (29%)
Similarity:73/164 (45%) Gaps:36/164 (22%)


  Fly    66 NHGGGSGTGMEH-MMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYY---R 125
            ||||.|  .|.| .|.|.|:..| |..|:|..|||..::..:.|::||.:|..::|.|:.:   :
pombe     2 NHGGNS--TMRHCSMKMTFNTDYDNLCIVFKSWHIGNLSQFLLSLLAIAILGYLFERLRSFTSLK 64

  Fly   126 EYLFWKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLH 190
            |..|.:.|        .|.|..                    |.:.| ...|:.|........|:
pombe    65 ETEFQRGY--------AGQQSE--------------------GLLTH-HSKSLKSGRPFRLCALY 100

  Fly   191 VLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGY 223
            .:|:..|:.|||:.||||.::.|.:.:|||.||
pombe   101 AVQLVFSYFLMLVAMTYNAYVILAIAIGAAFGY 133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 41/150 (27%)
ctr6NP_595861.1 Ctr 14..133 CDD:282057 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I1992
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 LDO PTHR12483
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4018
TreeFam 1 0.960
87.950

Return to query results.
Submit another query.