DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and ctr4

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_587968.1 Gene:ctr4 PomBaseID:SPCC1393.10 Length:289 Species:Schizosaccharomyces pombe

Alignment Length:228 Identity:51/229 (22%)
Similarity:89/229 (39%) Gaps:54/229 (24%)


  Fly    12 DHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGME 76
            |.||.    ||:..:|      .:||...:|.:.....|.:..|::..:.         ||..|.
pombe    62 DTSMS----GMNMTNS------TTPMSGMNMTNSTTSMSGMNMSNSTTSM---------SGMNMT 107

  Fly    77 HMMPMAFHFGYNETILFSW-----------WHIETVAGLIGSMIAIFLLALMYEGLKY-YREYLF 129
            :....|.......::.::|           |||.:....:||:..|..:.:..|.::. .||:..
pombe   108 NTTTTAKASSCKLSMYWNWYTIDACFITKHWHITSKHMFVGSIFGIIFMMMALELVRRGQREFDR 172

  Fly   130 WKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSI-NHLLQTLLHVLQ 193
            |                   ..|..|||:   :...:.|..||..|...|.| .|.|::..:::|
pombe   173 W-------------------CVRRFSPAS---NSCCHSGAPVHSGPSMALRIFLHFLRSCFYLVQ 215

  Fly   194 VTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLF 226
            ..::::.||:.|.||.::.|.:..|...|||||
pombe   216 YIVAYIAMLLAMYYNGYVILFLFCGTFFGYFLF 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 36/160 (23%)
ctr4NP_587968.1 Ctr 121..248 CDD:282057 35/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.