DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and Slc31a2

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_079562.1 Gene:Slc31a2 MGIID:1333844 Length:143 Species:Mus musculus

Alignment Length:155 Identity:52/156 (33%)
Similarity:78/156 (50%) Gaps:28/156 (18%)


  Fly    79 MPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPVTG 143
            |||.|.|.....:||.:|.:.:..|:..|::.:.|||::|||:|..:..|..||   ||..|.|.
Mouse     1 MPMHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKT---LESLPATN 62

  Fly   144 PQRNPEAPRIPSPAAAAPSP--------VQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLL 200
            .|:....|...|..:.:.|.        :.|.|                 |:|:||:||.:.:.:
Mouse    63 SQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFG-----------------QSLVHVIQVVIGYFV 110

  Fly   201 MLIFMTYNVWLCLMVVLGAAVGYFL 225
            ||..|:||.|:.|.||||:||||:|
Mouse   111 MLAVMSYNTWIFLGVVLGSAVGYYL 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 52/156 (33%)
Slc31a2NP_079562.1 Ctr 1..135 CDD:282057 51/154 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124002
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4018
TreeFam 1 0.960
76.930

Return to query results.
Submit another query.