DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and Y58A7A.1

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001256056.1 Gene:Y58A7A.1 WormBaseID:WBGene00021975 Length:163 Species:Caenorhabditis elegans

Alignment Length:219 Identity:59/220 (27%)
Similarity:87/220 (40%) Gaps:74/220 (34%)


  Fly    11 VDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGM 75
            :|||.|      ||.|.|....||.....:|                                  
 Worm     1 MDHSQH------HHVHKGTIGNTAVAQTKSS---------------------------------- 25

  Fly    76 EHMM---PMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLE 137
            :|||   .|:||||..|||||.:|..||..|:..:.....|||.:.|.|:::|:|.  |....|.
 Worm    26 DHMMMNHAMSFHFGTEETILFDFWKTETAVGIAVACFITVLLAFLMETLRFFRDYR--KAQTQLH 88

  Fly   138 YRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLML 202
            ..|::...|...:|::                             .|:..||.:.|:|:::.|||
 Worm    89 QPPISPEDRLKRSPQL-----------------------------DLIDPLLQLFQLTIAYFLML 124

  Fly   203 IFMTYNVWLCLMVVLGAAVGYFLF 226
            ||||:|.:||...|:|..|.:.|:
 Worm   125 IFMTFNAYLCFFTVVGEVVCHLLY 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 46/150 (31%)
Y58A7A.1NP_001256056.1 Ctr 34..147 CDD:282057 44/144 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4018
TreeFam 1 0.960
66.000

Return to query results.
Submit another query.