DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1A and K12C11.3

DIOPT Version :9

Sequence 1:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001293414.1 Gene:K12C11.3 / 187321 WormBaseID:WBGene00019674 Length:147 Species:Caenorhabditis elegans


Alignment Length:158 Identity:45/158 - (28%)
Similarity:69/158 - (43%) Gaps:31/158 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 MMPMA--------FHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYN 134
            |.||.        :|...|:.|||..|.::.:..:|.|...:.....:.|.|||.:    |..  
 Worm     8 MAPMGKTTKMWQWYHVELNDVILFENWKVQDMTTMIWSCFVVGFAGFLLEFLKYSK----WAA-- 66

  Fly   135 LLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLS-INHLLQTLLHVLQVTLSF 198
            .::.||.....|.                .:|.|.||..:....|. ..|::|.:.|..|..|:|
 Worm    67 SMQMRPAGDVDRR----------------TKYGGCVVPSENRKKLFWARHVVQAMYHFWQTLLAF 115

  Fly   199 LLMLIFMTYNVWLCLMVVLGAAVGYFLF 226
            :||.|:||:||::||.:.||..:|||.|
 Worm   116 ILMNIYMTFNVYICLSLCLGLTIGYFFF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 43/155 (28%)
K12C11.3NP_001293414.1 Ctr 17..143 CDD:282057 41/147 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.