DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and F01G12.1

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_510665.2 Gene:F01G12.1 WormBaseID:WBGene00017170 Length:306 Species:Caenorhabditis elegans

Alignment Length:258 Identity:60/259 (23%)
Similarity:97/259 (37%) Gaps:94/259 (36%)


  Fly     3 HAHHSAPGVDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNH 67
            |...:..|.||.:|::....||:..                                    :|:|
 Worm    87 HTETNQSGHDHHIHNNEEHKHHNMR------------------------------------SHDH 115

  Fly    68 GGGSGTGMEHMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLF--- 129
                     |.|.|.||:|::|.:||.:|.|:..    .:.:..|.:.|...|    |:.:.   
 Worm   116 ---------HTMKMWFHWGFDEVVLFDFWRIDDK----NANLFFFFVNLTRGG----RQTIISGK 163

  Fly   130 ---WKTYNLLEYRPVTGPQRNPEAP--RIPSPAAAAP---------------------SPV---- 164
               |:...:    .::|...|.:.|  ||.......|                     ||:    
 Worm   164 SENWQISGI----EISGKSANRQLPTCRICRKNGNLPKNFFMKDGRALREDFKDNNASSPLVNHS 224

  Fly   165 -QYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLF 226
             ....||.|   |..||:..|.|.:|:::|:..::.||||.||||:||.|.|:|||..|:::|
 Worm   225 RSTTPEVRH---PGPLSVVRLTQAVLYIVQLVFAYWLMLIVMTYNIWLTLAVILGAGFGHWIF 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 49/181 (27%)
F01G12.1NP_510665.2 TroA-like <87..>122 CDD:294188 12/80 (15%)
Ctr 118..284 CDD:282057 49/181 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130817026
eggNOG 1 0.900 E1_KOG3386
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3444
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 1 1.000 T98079
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.