DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and F58G6.7

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_501714.1 Gene:F58G6.7 WormBaseID:WBGene00010277 Length:166 Species:Caenorhabditis elegans

Alignment Length:168 Identity:48/169 (28%)
Similarity:65/169 (38%) Gaps:40/169 (24%)


  Fly    75 MEHMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKT------- 132
            |..||.|.|||...|.|||..|........:.|.|.|||:|...|.||:.|..|..|.       
 Worm     2 MHMMMEMYFHFRIEEPILFREWKPLNTTAYVFSCIEIFLIAFCLEALKFGRTKLSPKVKIVEKKV 66

  Fly   133 -----------YNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQ 186
                       :|:.|..|:|           ......||.           ...|::|..|:..
 Worm    67 DCCCSTEKDGLWNIPETIPLT-----------QKTVTLAPF-----------TRDSLISKFHMAS 109

  Fly   187 TLLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYF 224
            :||..:|..:.:.|||:.||||..:.|.::.|...|||
 Worm   110 SLLVFVQHFIDYSLMLVSMTYNWPIFLSLLAGHTTGYF 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 46/165 (28%)
F58G6.7NP_501714.1 Ctr 9..148 CDD:282057 44/162 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.