DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and F31E8.4

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_495391.1 Gene:F31E8.4 WormBaseID:WBGene00017954 Length:162 Species:Caenorhabditis elegans

Alignment Length:171 Identity:62/172 (36%)
Similarity:86/172 (50%) Gaps:20/172 (12%)


  Fly    79 MPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYL-FWKTYNLLEYRPVT 142
            |.|..|||..|.||||||...:::|:..||:..|||.::||.:|.:|.:| .|....        
 Worm     3 MDMTLHFGEREKILFSWWKTGSLSGMAVSMLITFLLCILYEAIKSFRYFLAVWNNQK-------- 59

  Fly   143 GPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLS--------INHLLQTLLHVLQVTLSFL 199
            ..||:.|| .|.:|..:....:.  .:.:|..|...||        ...|.|..|:.||..|::.
 Worm    60 RQQRHAEA-SITNPQNSGGDNIS--EDSIHIAPLVQLSGFTKRLFTSYRLAQGALYGLQALLAYT 121

  Fly   200 LMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHC 240
            ||||.||||:.|.|.:|:|.|||||||.....|...:|:.|
 Worm   122 LMLIAMTYNMNLILSIVVGEAVGYFLFTGNPLVEQHLTDCC 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 58/156 (37%)
F31E8.4NP_495391.1 Ctr 3..148 CDD:282057 58/156 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 1 1.000 T375207
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.970

Return to query results.
Submit another query.