DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and F27C1.2

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001021419.1 Gene:F27C1.2 WormBaseID:WBGene00017852 Length:256 Species:Caenorhabditis elegans

Alignment Length:226 Identity:74/227 (33%)
Similarity:110/227 (48%) Gaps:46/227 (20%)


  Fly    46 IPDTSDLQASHAGHAAHGAH-NHGGGSGTGMEHMMPMAFHFGYNETILFSWWHIETVAGLIGSMI 109
            :||..| |..|..|::||:| .|||..|    |||.|.||.|:.|.|||.:|..:::.|::.|..
 Worm    47 VPDEKD-QNEHHEHSSHGSHAGHGGHEG----HMMKMWFHGGFEEVILFDFWRTDSLFGMLLSCA 106

  Fly   110 AIFLLALMYEGLKYYREYL--------FWKTYNLLEY-------------RPVTGPQRN-PEAPR 152
            |||::...|||:|::|.:|        .....:.:|:             :.||..|.| |::..
 Worm   107 AIFIMGATYEGVKWFRVFLQMTQTQAQVLANKSCVEFALQTTRSSGGTCHQSVTHSQSNKPQSEP 171

  Fly   153 IPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFMTYNVWLCLMVVL 217
            ....|:.|.:|.           .|..|...|:|.||::.|:.|::.||||.||||.:|...|||
 Worm   172 FLISASVARTPA-----------TSPFSPQRLIQMLLYIFQLVLAYWLMLIVMTYNTYLTAAVVL 225

  Fly   218 GAAVGYFLF-------CWKKSVIVDVTEHCH 241
            ||..|::||       |..:......|:.||
 Worm   226 GAGFGHWLFAVLQLRNCDGEVTDSFQTDACH 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 54/169 (32%)
F27C1.2NP_001021419.1 Ctr 76..234 CDD:282057 54/169 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130817013
eggNOG 1 0.900 E1_KOG3386
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3444
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 1 1.000 T98079
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4018
TreeFam 1 0.960
1211.890

Return to query results.
Submit another query.